Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged RBL2 is 0.3 ng/ml as a capture antibody.)

Mouse RBL2 Monoclonal Antibody | anti-RBL2 antibody

RBL2 (Retinoblastoma-like 2 (p130), FLJ26459, P130, Rb2) (FITC)

Gene Names
RBL2; Rb2; P130
Applications
ELISA
Purity
Purified
Synonyms
RBL2; Monoclonal Antibody; RBL2 (Retinoblastoma-like 2 (p130); FLJ26459; P130; Rb2) (FITC); Retinoblastoma-like 2 (p130); Rb2; anti-RBL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D7
Specificity
Recognizes RBL2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-RBL2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RBL2 (NP_005602, 416aa-515aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VTPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLG
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RBL2 is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RBL2 is 0.3 ng/ml as a capture antibody.)
Related Product Information for anti-RBL2 antibody
Mouse monoclonal antibody raised against a partial recombinant RBL2.
Product Categories/Family for anti-RBL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,349 Da
NCBI Official Full Name
retinoblastoma-like protein 2 isoform 1
NCBI Official Synonym Full Names
RB transcriptional corepressor like 2
NCBI Official Symbol
RBL2
NCBI Official Synonym Symbols
Rb2; P130
NCBI Protein Information
retinoblastoma-like protein 2
UniProt Protein Name
Retinoblastoma-like protein 2
Protein Family
UniProt Gene Name
RBL2
UniProt Synonym Gene Names
RB2; p130; RBR-2
UniProt Entry Name
RBL2_HUMAN

Uniprot Description

Rb-like 2: Key regulator of entry into cell division. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Probably acts as a transcription repressor by recruiting chromatin-modifying enzymes to promoters. Potent inhibitor of E2F-mediated trans-activation, associates preferentially with E2F5. Binds to cyclins A and E. Binds to and may be involved in the transforming capacity of the adenovirus E1A protein. May act as a tumor suppressor. Belongs to the retinoblastoma protein (RB) family.

Protein type: Tumor suppressor; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 16q12.2

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; DNA binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent; regulation of cell cycle; mitotic cell cycle; regulation of lipid kinase activity; chromatin modification

Research Articles on RBL2

Similar Products

Product Notes

The RBL2 rbl2 (Catalog #AAA6177094) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RBL2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RBL2 rbl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.