Western Blot (WB)
(Western Blot detection against Immunogen (35.35kD).)
Mouse anti-Human RASSF3 Monoclonal Antibody | anti-RASSF3 antibody
RASSF3 (Ras Association Domain-containing Protein 3) (FITC)
Gene Names
RASSF3; RASSF5
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RASSF3; Monoclonal Antibody; RASSF3 (Ras Association Domain-containing Protein 3) (FITC); MGC119194; MGC119195; MGC119197; anti-RASSF3 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A5
Specificity
Recognizes human RASSF3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-RASSF3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa29-113 from human RASSF3 (NP_835463) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QGKPRSGQQDVEKEKETHSYLSKEEIKEKVHKYNLAVTDKLKMTLNSNGIYTGFIKVQMELCKPPQTSPNSGKLSPSSNGCMNT
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (35.35kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (35.35kD).)
Product Categories/Family for anti-RASSF3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
10,265 Da
NCBI Official Full Name
ras association domain-containing protein 3
NCBI Official Synonym Full Names
Ras association (RalGDS/AF-6) domain family member 3
NCBI Official Symbol
RASSF3
NCBI Official Synonym Symbols
RASSF5
NCBI Protein Information
ras association domain-containing protein 3; Ras association (RalGDS/AF-6) domain family 3
UniProt Protein Name
Ras association domain-containing protein 3
Protein Family
UniProt Gene Name
RASSF3
UniProt Entry Name
RASF3_HUMAN
NCBI Description
The RAS oncogene (MIM 190020) is mutated in nearly one-third of all human cancers. Members of the RAS superfamily are plasma membrane GTP-binding proteins that modulate intracellular signal transduction pathways. A subfamily of RAS effectors, including RASSF3, share a RAS association (RA) domain.[supplied by OMIM, Jul 2003]
Uniprot Description
RASSF3: 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Adaptor/scaffold
Chromosomal Location of Human Ortholog: 12q14.2
Cellular Component: microtubule; cytoplasm; plasma membrane
Molecular Function: identical protein binding; protein binding
Biological Process: signal transduction
Research Articles on RASSF3
Similar Products
Product Notes
The RASSF3 rassf3 (Catalog #AAA6149245) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RASSF3 (Ras Association Domain-containing Protein 3) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RASSF3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RASSF3 rassf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RASSF3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
