Mouse anti-Human RANBP7 Monoclonal Antibody | anti-RANBP7 antibody

RANBP7 (Importin-7, Imp7, Ran-binding Protein 7, RanBP7, IPO7) (Biotin)

Cat. Num. AAA6143915

• Gene Names: IPO7; Imp7; RANBP7
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RANBP7; Monoclonal Antibody; RANBP7 (Importin-7; Imp7; Ran-binding Protein 7; RanBP7; IPO7) (Biotin); anti-RANBP7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4G6
• Specificity: Recognizes human IPO7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 6162

• Applicable Applications for anti-RANBP7 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa950-1038 from IPO7 (NP_006382) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFSAPVVPSSFNFGGPAPGMN
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Western Blot (WB)

(IPO7 monoclonal antibody Western Blot analysis of IPO7 expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged IPO7 is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-RANBP7 antibody

The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. Similar to importin-beta, this protein prevents the activation of Ran's GTPase by RanGAP1 and inhibits nucleotide exchange on RanGTP, and also binds directly to nuclear pore complexes where it competes for binding sites with importin-beta and transportin. This protein has a Ran-dependent transport cycle and it can cross the nuclear envelope rapidly and in both directions. At least four importin beta-like transport receptors, namely importin beta itself, transportin, RanBP5 and RanBP7, directly bind and import ribosomal proteins.

Product Categories/Family for anti-RANBP7 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 1519315642
• NCBI GeneID: 10527
• NCBI Accession #: NM_006391.3
• NCBI GenBank Nucleotide #: NM_006391
• UniProt Accession #: O95373
• NCBI Official Full Name: Homo sapiens importin 7 (IPO7), mRNA
• NCBI Official Synonym Full Names: importin 7
• NCBI Official Symbol: IPO7
• NCBI Official Synonym Symbols: Imp7; RANBP7
• NCBI Protein Information: importin-7
• UniProt Protein Name: Importin-7
• UniProt Gene Name: IPO7
• UniProt Synonym Gene Names: RANBP7; Imp7; RanBP7
• UniProt Entry Name: IPO7_HUMAN

NCBI Description

The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. Similar to importin-beta, this protein prevents the activation of Ran's GTPase by RanGAP1 and inhibits nucleotide exchange on RanGTP, and also binds directly to nuclear pore complexes where it competes for binding sites with importin-beta and transportin. This protein has a Ran-dependent transport cycle and it can cross the nuclear envelope rapidly and in both directions. At least four importin beta-like transport receptors, namely importin beta itself, transportin, RanBP5 and RanBP7, directly bind and import ribosomal proteins. [provided by RefSeq, Jul 2008]

Uniprot Description

IPO7: a beta importin protein. Functions in nuclear protein import, either by acting as autonomous nuclear transport receptor or as an adapter-like protein in association with the importin beta-1 subunit. A receptor for nuclear localization signals (NLS) that promotes translocation of import substrates through the nuclear pore complex (NPC) by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran.

Protein type: Nuclear export; Karyopherin; Nuclear import

Chromosomal Location of Human Ortholog: 11p15.4

Cellular Component: nucleoplasm; membrane; cytoplasm; nuclear pore

Molecular Function: protein binding; histone binding; transporter activity; Ran GTPase binding

Biological Process: viral reproduction; regulation of catalytic activity; protein import into nucleus; innate immune response; signal transduction