Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RAD51C monoclonal antibody, Western Blot analysis of RAD51C expression in HeLa.)

Mouse anti-Human RAD51C Monoclonal Antibody | anti-RAD51C antibody

RAD51C (DNA Repair Protein RAD51 Homolog 3, R51H3, RAD51 Homolog C, RAD51-like Protein 2, MGC104277, RAD51L2) (AP)

Gene Names
RAD51C; FANCO; R51H3; BROVCA3; RAD51L2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAD51C; Monoclonal Antibody; RAD51C (DNA Repair Protein RAD51 Homolog 3; R51H3; RAD51 Homolog C; RAD51-like Protein 2; MGC104277; RAD51L2) (AP); anti-RAD51C antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3F3-5C6
Specificity
Recognizes human RAD51C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-RAD51C antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to human RAD51C, aa1-135 (AAH00667) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RAD51C monoclonal antibody, Western Blot analysis of RAD51C expression in HeLa.)

Western Blot (WB) (RAD51C monoclonal antibody, Western Blot analysis of RAD51C expression in HeLa.)

Western Blot (WB)

(RAD51C monoclonal antibody. Western Blot analysis of RAD51C expression in 293.)

Western Blot (WB) (RAD51C monoclonal antibody. Western Blot analysis of RAD51C expression in 293.)

Western Blot (WB)

(Western Blot analysis of RAD51C expression in transfected 293T cell line by RAD51C monoclonal antibody. Lane 1: RAD51C transfected lysate (42.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RAD51C expression in transfected 293T cell line by RAD51C monoclonal antibody. Lane 1: RAD51C transfected lysate (42.2kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RAD51C on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RAD51C on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RAD51C is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RAD51C is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of RAD51C over-expressed 293 cell line, cotransfected with RAD51C Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD51C monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of RAD51C over-expressed 293 cell line, cotransfected with RAD51C Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD51C monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-RAD51C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
14,883 Da
NCBI Official Full Name
Homo sapiens RAD51 homolog C (S. cerevisiae), mRNA
NCBI Official Synonym Full Names
RAD51 paralog C
NCBI Official Symbol
RAD51C
NCBI Official Synonym Symbols
FANCO; R51H3; BROVCA3; RAD51L2
NCBI Protein Information
DNA repair protein RAD51 homolog 3
Protein Family

NCBI Description

This gene is a member of the RAD51 family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51 and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with other RAD51 paralogs and is reported to be important for Holliday junction resolution. Mutations in this gene are associated with Fanconi anemia-like syndrome. This gene is one of four localized to a region of chromosome 17q23 where amplification occurs frequently in breast tumors. Overexpression of the four genes during amplification has been observed and suggests a possible role in tumor progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Research Articles on RAD51C

Similar Products

Product Notes

The RAD51C (Catalog #AAA6133295) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAD51C (DNA Repair Protein RAD51 Homolog 3, R51H3, RAD51 Homolog C, RAD51-like Protein 2, MGC104277, RAD51L2) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAD51C can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAD51C for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAD51C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.