Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RABIF Monoclonal Antibody | anti-RABIF antibody

RABIF (RAB interacting Factor, MSS4, RASGFR3, OTTHUMP00000038814, RAB-interacting Factor, Ras-specific guanine-releasing Factor 3, Guanine nucleotide exchange Factor MSS4, Mammalian suppressor of SEC4, RASGRF3) (HRP)

Gene Names
RABIF; MSS4; RASGFR3; RASGRF3
Reactivity
Human
Applications
ELISA
Purity
Purified
Synonyms
RABIF; Monoclonal Antibody; RABIF (RAB interacting Factor; MSS4; RASGFR3; OTTHUMP00000038814; RAB-interacting Factor; Ras-specific guanine-releasing Factor 3; Guanine nucleotide exchange Factor MSS4; Mammalian suppressor of SEC4; RASGRF3) (HRP); anti-RABIF antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G3
Specificity
Recognizes human RABIF.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
123
Applicable Applications for anti-RABIF antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa1-123 from full-length human RABIF with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-RABIF antibody
The Sec4/Rab-related small GTP-binding proteins are involved in the regulation of intracellular vesicular transport. Mss4 stimulates GTP-GDP exchange in Sec4 and Rab and binds to a subset of genetically related Rab proteins.
Product Categories/Family for anti-RABIF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
RAB interacting factor
NCBI Official Synonym Full Names
RAB interacting factor
NCBI Official Symbol
RABIF
NCBI Official Synonym Symbols
MSS4; RASGFR3; RASGRF3
NCBI Protein Information
guanine nucleotide exchange factor MSS4

NCBI Description

This gene encodes a member of the SCE4/YPT1/RAB family of small GTP-binding proteins that are involved in the regulation of intracellular vesicular transport. This protein stimulates GTP-GDP exchange in SEC4, and to a lesser extent in YPT1 and RAB3A, and may play a general role in vesicular transport. [provided by RefSeq, Oct 2011]

Research Articles on RABIF

Similar Products

Product Notes

The RABIF (Catalog #AAA6156145) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RABIF (RAB interacting Factor, MSS4, RASGFR3, OTTHUMP00000038814, RAB-interacting Factor, Ras-specific guanine-releasing Factor 3, Guanine nucleotide exchange Factor MSS4, Mammalian suppressor of SEC4, RASGRF3) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RABIF can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RABIF for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RABIF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.