Mouse anti-Human RAB8B Monoclonal Antibody | anti-RAB8B antibody

RAB8B (Ras-related Protein Rab-8B) (FITC)

Cat. Num. AAA6149185

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RAB8B; Monoclonal Antibody; RAB8B (Ras-related Protein Rab-8B) (FITC); FLJ38125; anti-RAB8B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1E4
• Specificity: Recognizes human RAB8B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-RAB8B antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa101-208 from human RAB8B (NP_057614) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.88kD).)

Testing Data

(Detection limit for recombinant GST tagged RAB8B is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-RAB8B antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 7706563
• NCBI GeneID: 51762
• NCBI Accession #: NP_057614
• NCBI GenBank Nucleotide #: NM_016530
• UniProt Accession #: Q92930; Q5JPC4; Q9P293
• Molecular Weight: 25.7kDa (227aa)
• NCBI Official Full Name: ras-related protein Rab-8B
• NCBI Official Synonym Full Names: RAB8B, member RAS oncogene family
• NCBI Official Symbol: RAB8B
• NCBI Protein Information: ras-related protein Rab-8B
• UniProt Protein Name: Ras-related protein Rab-8B
• Protein Family: Ras-related protein
• UniProt Gene Name: RAB8B
• UniProt Entry Name: RAB8B_HUMAN

NCBI Description

RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes (summary by Chen et al., 1997 [PubMed 9030196]).[supplied by OMIM, Nov 2010]

Uniprot Description

RAB8B: May be involved in vesicular trafficking and neurotransmitter release. May participate in cell junction dynamics in Sertoli cells. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein; Motility/polarity/chemotaxis; G protein, monomeric; G protein, monomeric, Rab

Chromosomal Location of Human Ortholog: 15q22.2

Cellular Component: peroxisomal membrane; phagocytic vesicle membrane; trans-Golgi network transport vesicle; synaptic vesicle; mitochondrion; perinuclear region of cytoplasm; secretory granule membrane; plasma membrane; phagocytic vesicle; endosome

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding; TPR domain binding; receptor binding

Biological Process: regulation of exocytosis; antigen processing and presentation; synaptic vesicle exocytosis; Golgi vesicle fusion to target membrane; cellular response to insulin stimulus; metabolic process; positive regulation of cell projection organization and biogenesis; protein secretion; cilium biogenesis; protein import into peroxisome membrane; Rab protein signal transduction; vesicle docking during exocytosis; positive regulation of adrenocorticotropic hormone secretion