SDS-PAGE
RNA exonuclease 4 (REXO4) Recombinant Protein | REXO4 recombinant protein
Recombinant Human RNA exonuclease 4 (REXO4)
Gene Names
REXO4; REX4; XPMC2; XPMC2H
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
RNA exonuclease 4 (REXO4); Recombinant Human RNA exonuclease 4 (REXO4); Exonuclease XPMC2; Prevents mitotic catastrophe 2 protein homolog; hPMC2; REXO4 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-422aa; Full Length
Sequence
MGKAKVPASKRAPSSPVAKPGPVKTLTRKKNKKKKRFWKSKAREVSKKPASGPGAVVRPPKAPEDFSQNWKALQEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMPAGKDQEASRGSVPSGSKMDRRAPVPRTKASGTEHNKKGTKERTNGDIVPERGDIEHKKRKAKEAAPAPPTEEDIWFDDVDPADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEMVGVGPKGEESMAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQGEELEVVQKEVAEMLKGRILVGHALHNDLKVLFLDHPKKKIRDTQKYKPFKSQVKSGRPSLRLLSEKILGLQVQQAEHCSIQDAQAAMRLYVMVKKEWESMARDRRPLLTAPDHCSDDA
Sequence Length
250
Species
Homo sapiens(Human)
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
SDS-PAGE
SDS-PAGE
Product Categories/Family for REXO4 recombinant protein
References
"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60.7 kDa
NCBI Official Full Name
RNA exonuclease 4 isoform 2
NCBI Official Synonym Full Names
REX4 homolog, 3'-5' exonuclease
NCBI Official Symbol
REXO4
NCBI Official Synonym Symbols
REX4; XPMC2; XPMC2H
NCBI Protein Information
RNA exonuclease 4
UniProt Protein Name
RNA exonuclease 4
UniProt Gene Name
REXO4
UniProt Synonym Gene Names
PMC2; XPMC2H; hPMC2
Research Articles on REXO4
Similar Products
Product Notes
The REXO4 rexo4 (Catalog #AAA7053579) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-422aa; Full Length. The amino acid sequence is listed below: MGKAKVPASK RAPSSPVAKP GPVKTLTRKK NKKKKRFWKS KAREVSKKPA SGPGAVVRPP KAPEDFSQNW KALQEWLLKQ KSQAPEKPLV ISQMGSKKKP KIIQQNKKET SPQVKGEEMP AGKDQEASRG SVPSGSKMDR RAPVPRTKAS GTEHNKKGTK ERTNGDIVPE RGDIEHKKRK AKEAAPAPPT EEDIWFDDVD PADIEAAIGP EAAKIARKQL GQSEGSVSLS LVKEQAFGGL TRALALDCEM VGVGPKGEES MAARVSIVNQ YGKCVYDKYV KPTEPVTDYR TAVSGIRPEN LKQGEELEVV QKEVAEMLKG RILVGHALHN DLKVLFLDHP KKKIRDTQKY KPFKSQVKSG RPSLRLLSEK ILGLQVQQAE HCSIQDAQAA MRLYVMVKKE WESMARDRRP LLTAPDHCSD DA. It is sometimes possible for the material contained within the vial of "RNA exonuclease 4 (REXO4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
