Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RAB1A Monoclonal Antibody | anti-RAB1A antibody

RAB1A (Ras-related Protein Rab-1A, YPT1-related Protein, RAB1, DKFZp564B163)

Gene Names
RAB1A; RAB1; YPT1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Ascites
Ascites
Synonyms
RAB1A; Monoclonal Antibody; RAB1A (Ras-related Protein Rab-1A; YPT1-related Protein; RAB1; DKFZp564B163); Anti -RAB1A (Ras-related Protein Rab-1A; anti-RAB1A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgM,k
Clone Number
3F10
Specificity
Recognizes human RAB1A.
Purity/Purification
Ascites
Ascites
Form/Format
Supplied as a liquid in ascites fluid.
Sequence
LQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC
Applicable Applications for anti-RAB1A antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa106-205, from human RAB1A, with GST tag.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-RAB1A antibody
Probably required for transit of protein from the ER through Golgi compartment. Binds GTP and GDP and possesses intrinsic GTPase activity.
Product Categories/Family for anti-RAB1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
22,678 Da
NCBI Official Full Name
RAB1A
NCBI Official Synonym Full Names
RAB1A, member RAS oncogene family
NCBI Official Symbol
RAB1A
NCBI Official Synonym Symbols
RAB1; YPT1
NCBI Protein Information
ras-related protein Rab-1A; YPT1-related protein; Rab GTPase YPT1 homolog; GTP binding protein Rab1a; RAB1, member RAS oncogene family
UniProt Protein Name
RAB1A protein
Protein Family
UniProt Gene Name
RAB1A
UniProt Entry Name
Q5U0I6_HUMAN

NCBI Description

This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multiple alternatively spliced transcript variants have been identified for this gene which encode different protein isoforms. [provided by RefSeq, Oct 2008]

Uniprot Description

Sequence similarities: Belongs to the small GTPase superfamily. Rab family. RuleBase RU003315

Research Articles on RAB1A

Similar Products

Product Notes

The RAB1A rab1a (Catalog #AAA649926) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAB1A (Ras-related Protein Rab-1A, YPT1-related Protein, RAB1, DKFZp564B163) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB1A can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the RAB1A rab1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LQEIDRYASE NVNKLLVGNK CDLTTKKVVD YTTAKEFADS LGIPFLETSA KNATNVEQSF MTMAAEIKKR MGPGATAGGA EKSNVKIQST PVKQSGGGC. It is sometimes possible for the material contained within the vial of "RAB1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.