Ras-related protein Rab-1A Recombinant Protein | RAB1A recombinant protein

Recombinant human Ras-related protein Rab-1A

Cat. Num. AAA717079

• Gene Names: RAB1A; RAB1; YPT1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ras-related protein Rab-1A; Recombinant human Ras-related protein Rab-1A; Recombinant human Ras-related protein Rab-1A protein; RAB1A recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence: SSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC-

• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

SDS-PAGE

Related Product Information for RAB1A recombinant protein

Probably required for transit of protein from the ER through Golgi compartment. Binds GTP and GDP and possesses intrinsic GTPase activity.

References

[1] "The human Rab genes encode a family of GTP-binding proteins related to yeast YPT1 and SEC4 products involved in secretion."

NCBI and Uniprot Product Information

• NCBI GI #: 207442673
• NCBI GeneID: 5861
• NCBI Accession #: NP_004152.1
• NCBI GenBank Nucleotide #: NM_004161.4
• UniProt Accession #: P62820; P11476; Q6FIE7; Q96N61; Q9Y3T2
• Molecular Weight: 48 KD
• NCBI Official Full Name: Homo sapiens RAB1A, member RAS oncogene family (RAB1A), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: RAB1A, member RAS oncogene family
• NCBI Official Symbol: RAB1A
• NCBI Official Synonym Symbols: RAB1; YPT1
• NCBI Protein Information: ras-related protein Rab-1A; YPT1-related protein; Rab GTPase YPT1 homolog; GTP binding protein Rab1a; RAB1, member RAS oncogene family
• UniProt Protein Name: Ras-related protein Rab-1A
• Protein Family: Ras-related protein
• UniProt Gene Name: RAB1A
• UniProt Synonym Gene Names: RAB1
• UniProt Entry Name: RAB1A_HUMAN

NCBI Description

This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multiple alternatively spliced transcript variants have been identified for this gene which encode different protein isoforms. [provided by RefSeq, Oct 2008]

Uniprot Description

Function: Probably required for transit of protein from the ER through Golgi compartment. Binds GTP and GDP and possesses intrinsic GTPase activity.

Subunit structure: May interact with YIPF5

By similarity.

Subcellular location: Golgi apparatus. Endoplasmic reticulum.

Post-translational modification: Phosphorylated by CDK1 kinase during mitosis. Ref.10 Ref.13 Ref.14Phosphocholinated at Ser-79 by L.pneumophila AnkX, leading to displace GDP dissociation inhibitors (GDI). Both GDP-bound and GTP-bound forms can be phosphocholinated. Dephosphocholinated by L.pneumophila Lem3, restoring accessibility to L.pneumophila GTPase effector LepB.

Sequence similarities: Belongs to the small GTPase superfamily. Rab family.