<
Western Blot (WB)
(QARS monoclonal antibody Western Blot analysis of QARS expression in HeLa.)
Mouse anti-Human QARS Monoclonal Antibody | anti-QARS antibody
QARS (Glutamine--tRNA Ligase, Glutaminyl-tRNA Synthetase, GlnRS) (Biotin)
Gene Names
QARS; GLNRS; MSCCA; PRO2195
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
QARS; Monoclonal Antibody; QARS (Glutamine--tRNA Ligase; Glutaminyl-tRNA Synthetase; GlnRS) (Biotin); anti-QARS antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5F5
Specificity
Recognizes human QARS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-QARS antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa677-776, from human QARS (NP_005042) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDPGKV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(QARS monoclonal antibody Western Blot analysis of QARS expression in HeLa.)
Western Blot (WB)
(QARS monoclonal antibody Western Blot analysis of QARS expression in HeLa.)
Western Blot (WB)
(Western Blot analysis of QARS expression in transfected 293T cell line by QARS monoclonal antibody. Lane 1: QARS transfected lysate (87.8kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of QARS expression in transfected 293T cell line by QARS monoclonal antibody. Lane 1: QARS transfected lysate (87.8kD). Lane 2: Non-transfected lysate.)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to QARS on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to QARS on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])
Immunoprecipitation (IP)
(Immunoprecipitation of QARS transfected lysate using QARS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with QARS rabbit polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of QARS transfected lysate using QARS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with QARS rabbit polyclonal antibody.)
Testing Data
(Detection limit for recombinant GST tagged QARS is ~1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged QARS is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-QARS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
86,579 Da
NCBI Official Full Name
glutamine--tRNA ligase isoform a
NCBI Official Synonym Full Names
glutaminyl-tRNA synthetase
NCBI Official Symbol
QARS
NCBI Official Synonym Symbols
GLNRS; MSCCA; PRO2195
NCBI Protein Information
glutamine--tRNA ligase; glutamine-tRNA synthetase
UniProt Protein Name
Glutamine--tRNA ligase
UniProt Gene Name
QARS
UniProt Synonym Gene Names
GlnRS
UniProt Entry Name
SYQ_HUMAN
Similar Products
Product Notes
The QARS qars (Catalog #AAA6143848) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The QARS (Glutamine--tRNA Ligase, Glutaminyl-tRNA Synthetase, GlnRS) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's QARS can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the QARS qars for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "QARS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
