Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human PXDN Monoclonal Antibody | anti-PXDN antibody

PXDN (Peroxidasin Homolog, Melanoma-associated Antigen MG50, Vascular Peroxidase 1, p53-responsive Gene 2 Protein, KIAA0230, MG50, PRG2, VPO, VPO1) (HRP)

Gene Names
PXDN; PXN; VPO; MG50; PRG2; ASGD7; COPOA; D2S448; D2S448E
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PXDN; Monoclonal Antibody; PXDN (Peroxidasin Homolog; Melanoma-associated Antigen MG50; Vascular Peroxidase 1; p53-responsive Gene 2 Protein; KIAA0230; MG50; PRG2; VPO; VPO1) (HRP); anti-PXDN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2C11
Specificity
Recognizes human PXDN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PXDN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1452-1562 from PXDN (XP_056455) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
STSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEK*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Testing Data

(Detection limit for recombinant GST tagged PXDN is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PXDN is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-PXDN antibody
Displays low peroxidase activity and is likely to participate in H2O2 metabolism and peroxidative reactions in the cardiovascular system. Plays a role in extracellular matrix formation.
Product Categories/Family for anti-PXDN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Synonym Full Names
peroxidasin
NCBI Official Symbol
PXDN
NCBI Official Synonym Symbols
PXN; VPO; MG50; PRG2; ASGD7; COPOA; D2S448; D2S448E
NCBI Protein Information
peroxidasin homolog

NCBI Description

This gene encodes a heme-containing peroxidase that is secreted into the extracellular matrix. It is involved in extracellular matrix formation, and may function in the physiological and pathological fibrogenic response in fibrotic kidney. Mutations in this gene cause corneal opacification and other ocular anomalies, and also microphthalmia and anterior segment dysgenesis. [provided by RefSeq, Aug 2014]

Research Articles on PXDN

Similar Products

Product Notes

The PXDN (Catalog #AAA6154449) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PXDN (Peroxidasin Homolog, Melanoma-associated Antigen MG50, Vascular Peroxidase 1, p53-responsive Gene 2 Protein, KIAA0230, MG50, PRG2, VPO, VPO1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PXDN can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PXDN for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PXDN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.