Mouse anti-Human PTPRU Monoclonal Antibody | anti-PTPRU antibody

PTPRU (Receptor-type Tyrosine-protein Phosphatase U, R-PTP-U, Pancreatic Carcinoma Phosphatase 2, PCP-2, Protein-tyrosine Phosphatase J, PTP-J, hPTP-J, Protein-tyrosine Phosphatase pi, PTP pi, Protein-tyrosine Phosphatase Receptor omicron, PTP-RO, Recepto

Cat. Num. AAA6192090

• Gene Names: PTPRO; NPHS6; PTPU2; GLEPP1; PTP-OC; PTP-U2; PTPROT; R-PTP-O
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PTPRU; Monoclonal Antibody; PTPRU (Receptor-type Tyrosine-protein Phosphatase U; R-PTP-U; Pancreatic Carcinoma Phosphatase 2; PCP-2; Protein-tyrosine Phosphatase J; PTP-J; hPTP-J; Protein-tyrosine Phosphatase pi; PTP pi; Protein-tyrosine Phosphatase Receptor omicron; PTP-RO; Recepto; anti-PTPRU antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F4
• Specificity: Recognizes human PTPRO.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.

• Applicable Applications for anti-PTPRU antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to human PTPRO, aa1-598 (AAH35960) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGHLPTGIHGARRLLPLLWLFVLFKNATAFHVTVQDDNNIVVSLEASDVISPASVYVVKITGESKNYFFEFEEFNSTLPPPVIFKASYHGLYYIITLVVVNGNVVTKPSRSITVLTKPLPVTSVSIYDYKPSPETGVLFEIHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWPDFNSSDYETTSQPYWWDSASAAPESEDEFVSVLPMEYENNSTLSETEKSTSGSFSFFPVQMILTWLPPKPPTAFDGFHIHIEREENFTEYLMVDEEAHEFVAELKEPGKYKLSVTTFSSSGSCETRKSQSAKSLSFYISPSGEWIEELTEKPQHVSVHVLSSTTALMSWTSSQENYNSTIVSVVSLTCQKQKESQRLEKQYCTQVNSSKPIIENLVPGAQYQVVIYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYPLGPTAVVLSWTRPYLGVFRKYVVEMFYFNPATMTSEWTTYYEIAATVSLTASVVIFP
• Conjugate: MaxLight405
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-PTPRU antibody

PTP-U, a member of the receptor class 2B subfamily of protein-tyrosine phosophatases, is involved in regulation of processes involving cell contact and adhesion such as growth control, tumor invasion, and metastasis. It forms complexes with beta-catenin and gamma-catenin/plakoglobin. This Type I membrane protein is found at high levels in brain, pancreas, and skeletal muscle; less in colon, kidney, liver, stomach, and uterus; no expression is observed in placenta and spleen. PTP-U is up-regulated upon cell contact. The protein contains 4 fibronectin type III domains, 1 immunoglobulin-like C2-type domain, 1 MAM domain, and 2 protein-tyrosine phosphatase domains.

Product Categories/Family for anti-PTPRU antibody

Antibodies; Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 23271166
• NCBI GeneID: 5800
• UniProt Accession #: Q16827; Q13101; Q9UBF0; Q9UBT5; A0AV39
• Molecular Weight: 138,344 Da
• NCBI Official Full Name: Homo sapiens protein tyrosine phosphatase, receptor type, O, mRNA
• NCBI Official Synonym Full Names: protein tyrosine phosphatase, receptor type, O
• NCBI Official Symbol: PTPRO
• NCBI Official Synonym Symbols: NPHS6; PTPU2; GLEPP1; PTP-OC; PTP-U2; PTPROT; R-PTP-O
• NCBI Protein Information: receptor-type tyrosine-protein phosphatase O; PTP phi; PTPase U2; phosphotyrosine phosphatase U2; glomerular epithelial protein 1; protein tyrosine phosphatase PTP-U2; osteoclastic transmembrane protein-tyrosine phosphatase
• UniProt Protein Name: Receptor-type tyrosine-protein phosphatase O
• Protein Family: Receptor-type tyrosine-protein phosphatase
• UniProt Gene Name: PTPRO
• UniProt Synonym Gene Names: GLEPP1; PTPU2; R-PTP-O; PTP-U2; PTPase U2
• UniProt Entry Name: PTPRO_HUMAN

NCBI Description

This gene encodes a member of the R3 subtype family of receptor-type protein tyrosine phosphatases. These proteins are localized to the apical surface of polarized cells and may have tissue-specific functions through activation of Src family kinases. This gene contains two distinct promoters, and alternatively spliced transcript variants encoding multiple isoforms have been observed. The encoded proteins may have multiple isoform-specific and tissue-specific functions, including the regulation of osteoclast production and activity, inhibition of cell proliferation and facilitation of apoptosis. This gene is a candidate tumor suppressor, and decreased expression of this gene has been observed in several types of cancer. [provided by RefSeq, May 2011]

Uniprot Description

PTPRO: Possesses tyrosine phosphatase activity. Plays a role in regulating the glomerular pressure/filtration rate relationship through an effect on podocyte structure and function. Defects in PTPRO are the cause of nephrotic syndrome type 6 (NPHS6). NPHS6 is a renal disease characterized clinically by proteinuria, hypoalbuminemia, hyperlipidemia and edema. Kidney biopsies show non-specific histologic changes such as focal segmental glomerulosclerosis and diffuse mesangial proliferation. Some affected individuals have an inherited steroid-resistant form and progress to end-stage renal failure. Belongs to the protein-tyrosine phosphatase family. Receptor class 3 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor protein phosphatase, tyrosine; EC 3.1.3.48; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 12p13.3-p13.2|12p13-p12

Cellular Component: neuron projection; growth cone; integral to plasma membrane; lamellipodium; axon; apical plasma membrane; integral to membrane; dendritic spine; plasma membrane; lateral plasma membrane

Molecular Function: Wnt-protein binding; protein binding; protein homodimerization activity; phosphoric monoester hydrolase activity; transmembrane receptor protein tyrosine phosphatase activity; protein tyrosine phosphatase activity

Biological Process: lamellipodium biogenesis; monocyte chemotaxis; axon guidance; regulation of glomerular filtration; negative regulation of glomerular filtration; cell morphogenesis; protein amino acid dephosphorylation; glomerulus development

Disease: Nephrotic Syndrome, Type 6