Rabbit PPARGC1A Polyclonal Antibody | anti-PPARGC1A antibody

PPARGC1A antibody - N-terminal region

Cat. Num. AAA3204399

• Gene Names: PPARGC1A; LEM6; PGC1; PGC1A; PGC-1v; PPARGC1; PGC-1alpha; PGC-1(alpha)
• Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: PPARGC1A; Polyclonal Antibody; PPARGC1A antibody - N-terminal region; anti-PPARGC1A antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS
• Sequence Length: 798

• Applicable Applications for anti-PPARGC1A antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 90%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPARGC1A
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:Lane1: 30 ug Human liverLane2: 30 ug Rat liverLane3: 30 ug Mouse (wild-type) liverLane4: 30 ug Mouse [AMPK alpha 1/2(-/-)] liverLane5: 30 ug Human muscleLane6: 30 ug Rat muscleLane7: 30 ug Mouse musclePrimary Antibody Dilution:1:1000Secondary Antibody:Secondary Antibody Dilution:1:10000Gene Name:PPARGC1ASubmitted by:Dr. Bruno Guigas, PhD, Dept. of Molecular Cell Biology, Leiden University Medical Center)

Western Blot (WB)

(PPARGC1A antibody - N-terminal region validated by WB using Transfected Melanoma Cell at 1:1000.)

Western Blot (WB)

(PPARGC1A antibody - N-terminal region validated by WB using transfected SH-SY5Y lysate at 1:15000.)

Western Blot (WB)

(WB Suggested Anti-PPARGC1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: ACHN cell lysate)

Related Product Information for anti-PPARGC1A antibody

This is a rabbit polyclonal antibody against PPARGC1A. It was validated on Western Blot

Target Description: The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.

Product Categories/Family for anti-PPARGC1A antibody

Polyclonal; Transcription Factor; RNA Binding Proteins; Transcription Regulation; Transcription Regulation; Cell Biology; Chromatin & Nuclear Signaling; Developmental Biology; Immunology; Mitochondria; DNA/RNA/Protein Interactions; Acetylation; Transcript

NCBI and Uniprot Product Information

• NCBI GI #: 7019499
• NCBI GeneID: 10891
• NCBI Accession #: NP_037393
• NCBI GenBank Nucleotide #: NM_013261
• UniProt Accession #: Q9UBK2
• Molecular Weight: 91kDa
• NCBI Official Full Name: peroxisome proliferator-activated receptor gamma coactivator 1-alpha isoform 2
• NCBI Official Synonym Full Names: PPARG coactivator 1 alpha
• NCBI Official Symbol: PPARGC1A
• NCBI Official Synonym Symbols: LEM6; PGC1; PGC1A; PGC-1v; PPARGC1; PGC-1alpha; PGC-1(alpha)
• NCBI Protein Information: peroxisome proliferator-activated receptor gamma coactivator 1-alpha
• UniProt Protein Name: Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
• Protein Family: Peroxisome proliferator-activated receptor gamma coactivator
• UniProt Gene Name: PPARGC1A
• UniProt Synonym Gene Names: LEM6; PGC1; PGC1A; PPARGC1; PGC-1-alpha; PPAR-gamma coactivator 1-alpha
• UniProt Entry Name: PRGC1_HUMAN

NCBI Description

The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. [provided by RefSeq, Jul 2008]