Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PTPN9 expression in transfected 293T cell line by PTPN9 monoclonal antibody (M04), clone 2F12.Lane 1: PTPN9 transfected lysate (Predicted MW: 65.23 KDa).Lane 2: Non-transfected lysate.)

Mouse PTPN9 Monoclonal Antibody | anti-PTPN9 antibody

PTPN9 (Protein Tyrosine Phosphatase, non-Receptor Type 9, MEG2, PTPMEG2) (FITC)

Gene Names
PTPN9; MEG2; PTPMEG2
Applications
Western Blot
Purity
Purified
Synonyms
PTPN9; Monoclonal Antibody; PTPN9 (Protein Tyrosine Phosphatase; non-Receptor Type 9; MEG2; PTPMEG2) (FITC); Protein Tyrosine Phosphatase; PTPMEG2; anti-PTPN9 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F12
Specificity
Recognizes PTPN9.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PTPN9 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PTPN9 (NP_002824.1, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEPATAPRPDMAPELTPEEEQATKQFLEEINKWTVQYNVSPLSWNVAVKFLMARKFDVLRAIELFHSYRETRRKEGIVKLKPHEEPLRSEILSGKFTILN
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PTPN9 expression in transfected 293T cell line by PTPN9 monoclonal antibody (M04), clone 2F12.Lane 1: PTPN9 transfected lysate (Predicted MW: 65.23 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PTPN9 expression in transfected 293T cell line by PTPN9 monoclonal antibody (M04), clone 2F12.Lane 1: PTPN9 transfected lysate (Predicted MW: 65.23 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PTPN9 is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PTPN9 is 0.3 ng/ml as a capture antibody.)
Related Product Information for anti-PTPN9 antibody
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an N-terminal domain that shares a significant similarity with yeast SEC14, which is a protein that has phosphatidylinositol transfer activity and is required for protein secretion through the Golgi complex in yeast. This PTP was found to be activated by polyphosphoinositide, and is thought to be involved in signaling events regulating phagocytosis. [provided by RefSeq]
Product Categories/Family for anti-PTPN9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68,020 Da
NCBI Official Full Name
tyrosine-protein phosphatase non-receptor type 9
NCBI Official Synonym Full Names
protein tyrosine phosphatase, non-receptor type 9
NCBI Official Symbol
PTPN9
NCBI Official Synonym Symbols
MEG2; PTPMEG2
NCBI Protein Information
tyrosine-protein phosphatase non-receptor type 9; PTPase MEG2; PTPase-MEG2; protein-tyrosine phosphatase MEG2
UniProt Protein Name
Tyrosine-protein phosphatase non-receptor type 9
UniProt Gene Name
PTPN9
UniProt Synonym Gene Names
PTPase MEG2
UniProt Entry Name
PTN9_HUMAN

Similar Products

Product Notes

The PTPN9 ptpn9 (Catalog #AAA6178787) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PTPN9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTPN9 ptpn9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTPN9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.