Mouse anti-Human PTPN5 Monoclonal Antibody | anti-PTPN5 antibody

PTPN5 (STEP, Tyrosine-protein Phosphatase Non-receptor Type 5, Striatum-enriched Protein-tyrosine Phosphatase, Neural-specific Protein-tyrosine Phosphatase, FLJ14427) (PE)

Cat. Num. AAA6159737

• Gene Names: PTPN5; STEP; STEP61; PTPSTEP
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PTPN5; Monoclonal Antibody; PTPN5 (STEP; Tyrosine-protein Phosphatase Non-receptor Type 5; Striatum-enriched Protein-tyrosine Phosphatase; Neural-specific Protein-tyrosine Phosphatase; FLJ14427) (PE); anti-PTPN5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2H5
• Specificity: Recognizes human PTPN5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 565

• Applicable Applications for anti-PTPN5 antibody: ELISA (EIA), Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa388-487 from human PTPN5 (NP_116170) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: WQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEG
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of PTPN5 transfected lysate using PTPN5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with PTPN5 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged PTPN5 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-PTPN5 antibody

STEP (striatum-enriched phosphatase) is a neural-specific protein-tyrosine phosphatase, first isolated from the rat brain. The 537aa predicted human protein as isolated from cDNA sequences is between 85 and 90% identical to the mouse and rat sequences. In rat neuronal cell cultures, glutamate-mediated activation of N-methyl-D-aspartate (NMDA) receptors leads to the rapid but transient phosphorylation of extracellular signal-related kinase-2 (ERK2). NMDA-mediated influx of calcium, activates the calcium-dependent phosphatase calcineurin and the resulting dephosphorylation and activation of STEP. STEP then inactivatea ERK2 through tyrosine dephosphorylation and blocks translocation of the kinase to the nucleus. STEP plays a significant role in regulating the ERK activation and downstream signaling in neurons.

Product Categories/Family for anti-PTPN5 antibody

Antibodies; Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 90652853
• NCBI GeneID: 84867
• NCBI Accession #: NP_116170
• NCBI GenBank Nucleotide #: NM_032781
• UniProt Accession #: P54829
• NCBI Official Full Name: tyrosine-protein phosphatase non-receptor type 5 isoform a
• NCBI Official Synonym Full Names: protein tyrosine phosphatase non-receptor type 5
• NCBI Official Symbol: PTPN5
• NCBI Official Synonym Symbols: STEP; STEP61; PTPSTEP
• NCBI Protein Information: tyrosine-protein phosphatase non-receptor type 5
• UniProt Protein Name: Tyrosine-protein phosphatase non-receptor type 5
• Protein Family: Tyrosine-protein phosphatase non-receptor
• UniProt Gene Name: PTPN5
• UniProt Synonym Gene Names: STEP
• UniProt Entry Name: PTN5_HUMAN

Uniprot Description

STEP: a non-receptor protein-tyrosine phosphatase. STEP (striatum enriched phosphatase) Contains a single phosphatase catalytic domain located at the C-terminus. Two alternatively-spliced messages have been described.

Protein type: Motility/polarity/chemotaxis; Protein phosphatase, tyrosine (non-receptor); EC 3.1.3.48; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11p15.1

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: phosphotyrosine binding; protein tyrosine phosphatase activity

Biological Process: protein amino acid dephosphorylation