Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of PTPN5 transfected lysate using PTPN5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with PTPN5 rabbit polyclonal antibody.)

Mouse anti-Human PTPN5 Monoclonal Antibody | anti-PTPN5 antibody

PTPN5 (STEP, Tyrosine-protein Phosphatase Non-receptor Type 5, Striatum-enriched Protein-tyrosine Phosphatase, Neural-specific Protein-tyrosine Phosphatase, FLJ14427) (AP)

Gene Names
PTPN5; STEP; STEP61; PTPSTEP
Reactivity
Human
Applications
ELISA, Immunoprecipitation
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PTPN5; Monoclonal Antibody; PTPN5 (STEP; Tyrosine-protein Phosphatase Non-receptor Type 5; Striatum-enriched Protein-tyrosine Phosphatase; Neural-specific Protein-tyrosine Phosphatase; FLJ14427) (AP); anti-PTPN5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2H5
Specificity
Recognizes human PTPN5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
565
Applicable Applications for anti-PTPN5 antibody
ELISA (EIA), Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa388-487 from human PTPN5 (NP_116170) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of PTPN5 transfected lysate using PTPN5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with PTPN5 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of PTPN5 transfected lysate using PTPN5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with PTPN5 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged PTPN5 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PTPN5 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-PTPN5 antibody
STEP (striatum-enriched phosphatase) is a neural-specific protein-tyrosine phosphatase, first isolated from the rat brain. The 537aa predicted human protein as isolated from cDNA sequences is between 85 and 90% identical to the mouse and rat sequences. In rat neuronal cell cultures, glutamate-mediated activation of N-methyl-D-aspartate (NMDA) receptors leads to the rapid but transient phosphorylation of extracellular signal-related kinase-2 (ERK2). NMDA-mediated influx of calcium, activates the calcium-dependent phosphatase calcineurin and the resulting dephosphorylation and activation of STEP. STEP then inactivatea ERK2 through tyrosine dephosphorylation and blocks translocation of the kinase to the nucleus. STEP plays a significant role in regulating the ERK activation and downstream signaling in neurons.
Product Categories/Family for anti-PTPN5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
tyrosine-protein phosphatase non-receptor type 5 isoform a
NCBI Official Synonym Full Names
protein tyrosine phosphatase non-receptor type 5
NCBI Official Symbol
PTPN5
NCBI Official Synonym Symbols
STEP; STEP61; PTPSTEP
NCBI Protein Information
tyrosine-protein phosphatase non-receptor type 5
UniProt Protein Name
Tyrosine-protein phosphatase non-receptor type 5
UniProt Gene Name
PTPN5
UniProt Synonym Gene Names
STEP
UniProt Entry Name
PTN5_HUMAN

Uniprot Description

STEP: a non-receptor protein-tyrosine phosphatase. STEP (striatum enriched phosphatase) Contains a single phosphatase catalytic domain located at the C-terminus. Two alternatively-spliced messages have been described.

Protein type: Motility/polarity/chemotaxis; Protein phosphatase, tyrosine (non-receptor); EC 3.1.3.48; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11p15.1

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: phosphotyrosine binding; protein tyrosine phosphatase activity

Biological Process: protein amino acid dephosphorylation

Research Articles on PTPN5

Similar Products

Product Notes

The PTPN5 ptpn5 (Catalog #AAA6133222) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PTPN5 (STEP, Tyrosine-protein Phosphatase Non-receptor Type 5, Striatum-enriched Protein-tyrosine Phosphatase, Neural-specific Protein-tyrosine Phosphatase, FLJ14427) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTPN5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTPN5 ptpn5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTPN5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.