Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse PTF1A Monoclonal Antibody | anti-PTF1A antibody

PTF1A (pancreas Specific Transcription Factor, 1a, PTF1-p48, bHLHa29) (Biotin)

Gene Names
PTF1A; p48; PACA; PAGEN2; bHLHa29; PTF1-p48
Applications
Western Blot
Purity
Purified
Synonyms
PTF1A; Monoclonal Antibody; PTF1A (pancreas Specific Transcription Factor; 1a; PTF1-p48; bHLHa29) (Biotin); pancreas Specific Transcription Factor; bHLHa29; anti-PTF1A antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1B8
Specificity
Recognizes PTF1A.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PTF1A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PTF1A (NP_835455, 250aa-328aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-PTF1A antibody
This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. [provided by RefSeq]
Product Categories/Family for anti-PTF1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
pancreas transcription factor 1 subunit alpha
NCBI Official Synonym Full Names
pancreas associated transcription factor 1a
NCBI Official Symbol
PTF1A
NCBI Official Synonym Symbols
p48; PACA; PAGEN2; bHLHa29; PTF1-p48
NCBI Protein Information
pancreas transcription factor 1 subunit alpha
UniProt Protein Name
Pancreas transcription factor 1 subunit alpha
UniProt Gene Name
PTF1A
UniProt Synonym Gene Names
BHLHA29; PTF1P48; bHLHa29; PTF1-p48
UniProt Entry Name
PTF1A_HUMAN

NCBI Description

This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. [provided by RefSeq, Jul 2008]

Uniprot Description

PTF1A: Transcriptional activator. Binds to the E-box consensus sequence 5'-CANNTG-3'. Plays an important role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. May be involved in the maintenance of exocrine pancreas-specific gene expression including ELA1 and amylase. Required for the formation of pancreatic acinar and ductal cells. Plays an important role in cerebellar development. Defects in PTF1A are the cause of diabetes mellitus and cerebellar hypoplasia/agenesis (DMCH).

Chromosomal Location of Human Ortholog: 10p12.2

Cellular Component: transcription factor complex; cytoplasm; nucleus

Molecular Function: protein dimerization activity; DNA binding; sequence-specific DNA binding; chromatin binding

Biological Process: retinoic acid receptor signaling pathway; tissue development; embryonic development; regulation of transcription, DNA-dependent; transcription, DNA-dependent; pancreas development; exocrine pancreas development; neuron fate commitment; cerebellum development; positive regulation of transcription from RNA polymerase II promoter; endocrine pancreas development

Disease: Pancreatic And Cerebellar Agenesis; Pancreatic Agenesis 2

Research Articles on PTF1A

Similar Products

Product Notes

The PTF1A ptf1a (Catalog #AAA6172162) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PTF1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTF1A ptf1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTF1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.