Mouse PTF1A Monoclonal Antibody | anti-PTF1A antibody

PTF1A (pancreas Specific Transcription Factor, 1a, PTF1-p48, bHLHa29) (Biotin)

Cat. Num. AAA6172122

• Gene Names: PTF1A; p48; PACA; PAGEN2; bHLHa29; PTF1-p48
• Applications: Western Blot
• Purity: Purified
• Synonyms: PTF1A; Monoclonal Antibody; PTF1A (pancreas Specific Transcription Factor; 1a; PTF1-p48; bHLHa29) (Biotin); pancreas Specific Transcription Factor; bHLHa29; anti-PTF1A antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4B1
• Specificity: Recognizes PTF1A.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-PTF1A antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PTF1A (NP_835455, 250aa-328aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PTF1A is approximately 0.1ng/ml as a capture antibody.)

Related Product Information for anti-PTF1A antibody

This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. [provided by RefSeq]

Product Categories/Family for anti-PTF1A antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 30039710
• NCBI GeneID: 256297
• NCBI Accession #: NP_835455
• NCBI GenBank Nucleotide #: NM_178161
• UniProt Accession #: Q7RTS3
• Molecular Weight: 35kDa
• NCBI Official Full Name: pancreas transcription factor 1 subunit alpha
• NCBI Official Synonym Full Names: pancreas associated transcription factor 1a
• NCBI Official Symbol: PTF1A
• NCBI Official Synonym Symbols: p48; PACA; PAGEN2; bHLHa29; PTF1-p48
• NCBI Protein Information: pancreas transcription factor 1 subunit alpha
• UniProt Protein Name: Pancreas transcription factor 1 subunit alpha
• Protein Family: Pancreas transcription factor
• UniProt Gene Name: PTF1A
• UniProt Synonym Gene Names: BHLHA29; PTF1P48; bHLHa29; PTF1-p48
• UniProt Entry Name: PTF1A_HUMAN

NCBI Description

This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. [provided by RefSeq, Jul 2008]

Uniprot Description

PTF1A: Transcriptional activator. Binds to the E-box consensus sequence 5'-CANNTG-3'. Plays an important role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. May be involved in the maintenance of exocrine pancreas-specific gene expression including ELA1 and amylase. Required for the formation of pancreatic acinar and ductal cells. Plays an important role in cerebellar development. Defects in PTF1A are the cause of diabetes mellitus and cerebellar hypoplasia/agenesis (DMCH).

Chromosomal Location of Human Ortholog: 10p12.2

Cellular Component: transcription factor complex; cytoplasm; nucleus

Molecular Function: protein dimerization activity; DNA binding; sequence-specific DNA binding; chromatin binding

Biological Process: retinoic acid receptor signaling pathway; tissue development; embryonic development; regulation of transcription, DNA-dependent; transcription, DNA-dependent; pancreas development; exocrine pancreas development; neuron fate commitment; cerebellum development; positive regulation of transcription from RNA polymerase II promoter; endocrine pancreas development

Disease: Pancreatic And Cerebellar Agenesis; Pancreatic Agenesis 2