Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PSMD5 monoclonal antibody, Western Blot analysis of PSMD5 expression in A-431.)

Mouse anti-Human PSMD5 Monoclonal Antibody | anti-PSMD5 antibody

PSMD5 (26S Proteasome non-ATPase Regulatory Subunit 5, 26S Proteasome Subunit S5B, 26S Protease Subunit S5 Basic, KIAA0072) (FITC)

Gene Names
PSMD5; S5B
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PSMD5; Monoclonal Antibody; PSMD5 (26S Proteasome non-ATPase Regulatory Subunit 5; 26S Proteasome Subunit S5B; 26S Protease Subunit S5 Basic; KIAA0072) (FITC); anti-PSMD5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3E2
Specificity
Recognizes human PSMD5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PSMD5 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa405-505, from human PSMD5 (AAH14478) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QPFPELHCAALKVFTAIANQPWAQKLMFNSPGFVEYVVDRSVEHDKASKDAKYELVKALANSKTIAEIFGNPNYLRLRTYLSEGPYYVKPVSTTAVEGAE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PSMD5 monoclonal antibody, Western Blot analysis of PSMD5 expression in A-431.)

Western Blot (WB) (PSMD5 monoclonal antibody, Western Blot analysis of PSMD5 expression in A-431.)

Immunohistochemistry (IHC)

(mmunoperoxidase of monoclonal antibody to PSMD5 on formalin-fixed paraffin-embedded human prostate.)

Immunohistochemistry (IHC) (mmunoperoxidase of monoclonal antibody to PSMD5 on formalin-fixed paraffin-embedded human prostate.)

Testing Data

(Detection limit for recombinant GST tagged PSMD5 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PSMD5 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-PSMD5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
51,312 Da
NCBI Official Full Name
Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 5, mRNA
NCBI Official Synonym Full Names
proteasome 26S subunit, non-ATPase 5
NCBI Official Symbol
PSMD5
NCBI Official Synonym Symbols
S5B
NCBI Protein Information
26S proteasome non-ATPase regulatory subunit 5

NCBI Description

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a non-ATPase subunit of the 19S regulator base that functions as a chaperone protein during 26S proteasome assembly. [provided by RefSeq, Jul 2012]

Research Articles on PSMD5

Similar Products

Product Notes

The PSMD5 (Catalog #AAA6149102) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PSMD5 (26S Proteasome non-ATPase Regulatory Subunit 5, 26S Proteasome Subunit S5B, 26S Protease Subunit S5 Basic, KIAA0072) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PSMD5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PSMD5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PSMD5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.