Mouse anti-Human PSMD5 Monoclonal Antibody | anti-PSMD5 antibody

PSMD5 (26S Proteasome non-ATPase Regulatory Subunit 5, 26S Proteasome Subunit S5B, 26S Protease Subunit S5 Basic, KIAA0072) APC

Cat. Num. AAA6138496

• Gene Names: PSMD5; S5B
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PSMD5; Monoclonal Antibody; PSMD5 (26S Proteasome non-ATPase Regulatory Subunit 5; 26S Proteasome Subunit S5B; 26S Protease Subunit S5 Basic; KIAA0072) APC; anti-PSMD5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3E2
• Specificity: Recognizes human PSMD5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-PSMD5 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa405-505, from human PSMD5 (AAH14478) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QPFPELHCAALKVFTAIANQPWAQKLMFNSPGFVEYVVDRSVEHDKASKDAKYELVKALANSKTIAEIFGNPNYLRLRTYLSEGPYYVKPVSTTAVEGAE
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PSMD5 monoclonal antibody, Western Blot analysis of PSMD5 expression in A-431.)

Immunohistochemistry (IHC)

(mmunoperoxidase of monoclonal antibody to PSMD5 on formalin-fixed paraffin-embedded human prostate.)

Testing Data

(Detection limit for recombinant GST tagged PSMD5 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-PSMD5 antibody

Antibodies; Proteasomes

NCBI and Uniprot Product Information

• NCBI GI #: 15680246
• NCBI GeneID: 5711
• Molecular Weight: 51,312 Da
• NCBI Official Full Name: Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 5, mRNA
• NCBI Official Synonym Full Names: proteasome 26S subunit, non-ATPase 5
• NCBI Official Symbol: PSMD5
• NCBI Official Synonym Symbols: S5B
• NCBI Protein Information: 26S proteasome non-ATPase regulatory subunit 5
• Protein Family: 26S proteasome non-ATPase regulatory

NCBI Description

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a non-ATPase subunit of the 19S regulator base that functions as a chaperone protein during 26S proteasome assembly. [provided by RefSeq, Jul 2012]