Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PRRX1 expression in transfected 293T cell line by PRRX1 monoclonal antibody (M01), clone 1E2.Lane 1: PRRX1 transfected lysate (Predicted MW: 24.4 KDa).Lane 2: Non-transfected lysate.)

Mouse PRRX1 Monoclonal Antibody | anti-PRRX1 antibody

PRRX1 (Paired Related Homeobox 1, PHOX1, PMX1, PRX1) (FITC)

Gene Names
PRRX1; PMX1; PRX1; AGOTC; PHOX1; PRX-1
Applications
Western Blot
Purity
Purified
Synonyms
PRRX1; Monoclonal Antibody; PRRX1 (Paired Related Homeobox 1; PHOX1; PMX1; PRX1) (FITC); Paired Related Homeobox 1; PRX1; anti-PRRX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
100
Specificity
Recognizes PRRX1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PRRX1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PRRX1 (NP_073207, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PRRX1 expression in transfected 293T cell line by PRRX1 monoclonal antibody (M01), clone 1E2.Lane 1: PRRX1 transfected lysate (Predicted MW: 24.4 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PRRX1 expression in transfected 293T cell line by PRRX1 monoclonal antibody (M01), clone 1E2.Lane 1: PRRX1 transfected lysate (Predicted MW: 24.4 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PRRX1 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PRRX1 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-PRRX1 antibody
The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. [provided by RefSeq]
Product Categories/Family for anti-PRRX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 27 kDa

Observed: 26 kDa
NCBI Official Full Name
paired mesoderm homeobox protein 1 isoform pmx-1b
NCBI Official Synonym Full Names
paired related homeobox 1
NCBI Official Symbol
PRRX1
NCBI Official Synonym Symbols
PMX1; PRX1; AGOTC; PHOX1; PRX-1
NCBI Protein Information
paired mesoderm homeobox protein 1; homeobox protein PHOX1; paired mesoderm homeobox 1 isoform pmx-1b
UniProt Protein Name
Paired mesoderm homeobox protein 1
UniProt Gene Name
PRRX1
UniProt Synonym Gene Names
PMX1; PRX-1
UniProt Entry Name
PRRX1_HUMAN

NCBI Description

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. [provided by RefSeq, Jul 2008]

Uniprot Description

PRRX1: Acts as a transcriptional regulator of muscle creatine kinase (MCK) and so has a role in the establishment of diverse mesodermal muscle types. The protein binds to an A/T-rich element in the muscle creatine enhancer. Defects in PRRX1 are the cause of agnathia-otocephaly complex (AGOTC). AGOTC is a rare condition characterized by mandibular hypoplasia or agnathia, ventromedial auricular malposition (melotia) and/or auricular fusion (synotia), and microstomia with oroglossal hypoplasia or aglossia. Holoprosencephaly is the most commonly identified association, but skeletal, genitourinary, and cardiovascular anomalies, and situs inversus have been reported. The disorder is almost always lethal. Belongs to the paired homeobox family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 1q24

Cellular Component: nucleolus; nucleus

Molecular Function: sequence-specific DNA binding; transcription coactivator activity

Biological Process: inner ear morphogenesis; cartilage development; positive regulation of mesenchymal cell proliferation; positive regulation of smoothened signaling pathway; artery morphogenesis; palate development; embryonic cranial skeleton morphogenesis; negative regulation of transcription from RNA polymerase II promoter; middle ear morphogenesis; embryonic limb morphogenesis

Disease: Agnathia-otocephaly Complex

Research Articles on PRRX1

Similar Products

Product Notes

The PRRX1 prrx1 (Catalog #AAA6178923) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PRRX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRRX1 prrx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRRX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.