Mouse PRRX1 Monoclonal Antibody | anti-PRRX1 antibody

PRRX1 (Paired Related Homeobox 1, PHOX1, PMX1, PRX1) (PE)

Cat. Num. AAA6187743

• Gene Names: PRRX1; PMX1; PRX1; AGOTC; PHOX1; PRX-1
• Applications: Western Blot
• Purity: Purified
• Synonyms: PRRX1; Monoclonal Antibody; PRRX1 (Paired Related Homeobox 1; PHOX1; PMX1; PRX1) (PE); Paired Related Homeobox 1; PRX1; anti-PRRX1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 100
• Specificity: Recognizes PRRX1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-PRRX1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PRRX1 (NP_073207, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKK
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PRRX1 expression in transfected 293T cell line by PRRX1 monoclonal antibody (M01), clone 1E2.Lane 1: PRRX1 transfected lysate (Predicted MW: 24.4 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PRRX1 is 0.03 ng/ml as a capture antibody.)

Related Product Information for anti-PRRX1 antibody

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. [provided by RefSeq]

Product Categories/Family for anti-PRRX1 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 12707577
• NCBI GeneID: 5396
• NCBI Accession #: NP_073207
• NCBI GenBank Nucleotide #: NM_022716.3
• UniProt Accession #: P54821; O60807; B5BUM7
• Molecular Weight: Predicted: 27 kDa; ; Observed: 26 kDa
• NCBI Official Full Name: paired mesoderm homeobox protein 1 isoform pmx-1b
• NCBI Official Synonym Full Names: paired related homeobox 1
• NCBI Official Symbol: PRRX1
• NCBI Official Synonym Symbols: PMX1; PRX1; AGOTC; PHOX1; PRX-1
• NCBI Protein Information: paired mesoderm homeobox protein 1; homeobox protein PHOX1; paired mesoderm homeobox 1 isoform pmx-1b
• UniProt Protein Name: Paired mesoderm homeobox protein 1
• Protein Family: Paired mesoderm homeobox protein
• UniProt Gene Name: PRRX1
• UniProt Synonym Gene Names: PMX1; PRX-1
• UniProt Entry Name: PRRX1_HUMAN

NCBI Description

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. [provided by RefSeq, Jul 2008]

Uniprot Description

PRRX1: Acts as a transcriptional regulator of muscle creatine kinase (MCK) and so has a role in the establishment of diverse mesodermal muscle types. The protein binds to an A/T-rich element in the muscle creatine enhancer. Defects in PRRX1 are the cause of agnathia-otocephaly complex (AGOTC). AGOTC is a rare condition characterized by mandibular hypoplasia or agnathia, ventromedial auricular malposition (melotia) and/or auricular fusion (synotia), and microstomia with oroglossal hypoplasia or aglossia. Holoprosencephaly is the most commonly identified association, but skeletal, genitourinary, and cardiovascular anomalies, and situs inversus have been reported. The disorder is almost always lethal. Belongs to the paired homeobox family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 1q24

Cellular Component: nucleolus; nucleus

Molecular Function: sequence-specific DNA binding; transcription coactivator activity

Biological Process: inner ear morphogenesis; cartilage development; positive regulation of mesenchymal cell proliferation; positive regulation of smoothened signaling pathway; artery morphogenesis; palate development; embryonic cranial skeleton morphogenesis; negative regulation of transcription from RNA polymerase II promoter; middle ear morphogenesis; embryonic limb morphogenesis

Disease: Agnathia-otocephaly Complex