Mouse anti-Human Prolactin Receptor Monoclonal Antibody | anti-PRLR antibody

Prolactin Receptor (PRLR, PRL-R, PRL Receptor) (HRP)

Cat. Num. AAA6154365

• Gene Names: PRLR; HPRL; MFAB; hPRLrI
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Prolactin Receptor; Monoclonal Antibody; Prolactin Receptor (PRLR; PRL-R; PRL Receptor) (HRP); anti-PRLR antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1E4
• Specificity: Recognizes human PRLR.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-PRLR antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa371-480, from human PRLR (NP_000940) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREV
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PRLR monoclonal antibody. Western Blot analysis of PRLR expression in A-431.)

Product Categories/Family for anti-PRLR antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 4506107
• NCBI GeneID: 5618
• NCBI Accession #: NP_000940
• NCBI GenBank Nucleotide #: NM_000949
• UniProt Accession #: P16471; Q16354; Q8TD75; Q8TD78; Q96P35; Q96P36; Q9BX87; Q9UHJ5; B2R882; D1MDP1
• Molecular Weight: 35,011 Da
• NCBI Official Full Name: prolactin receptor isoform 1
• NCBI Official Synonym Full Names: prolactin receptor
• NCBI Official Symbol: PRLR
• NCBI Official Synonym Symbols: HPRL; MFAB; hPRLrI
• NCBI Protein Information: prolactin receptor; hPRL receptor; secreted prolactin binding protein
• UniProt Protein Name: Prolactin receptor
• Protein Family: Prolactin receptor
• UniProt Gene Name: PRLR
• UniProt Synonym Gene Names: PRL-R
• UniProt Entry Name: PRLR_HUMAN

Uniprot Description

PRLR: receptor for the anterior pituitary hormone prolactin and placental lactogen I and II. Interacts with Cyclophilin A, differentially regulating various signaling pathways from the PrlR. Prolactin signaling is attenuated by threonine and tyrosine phosphorylation. Two alternative splice isoforms have been identified.

Protein type: Receptor, cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 5p13.2

Cellular Component: cell surface; integral to membrane; plasma membrane; extracellular region

Molecular Function: protein binding; protein homodimerization activity; ornithine decarboxylase activator activity; peptide hormone binding; metal ion binding; prolactin receptor activity

Biological Process: regulation of cell adhesion; lactation; transmembrane receptor protein tyrosine kinase activation (dimerization); cell surface receptor linked signal transduction; T cell activation; regulation of epithelial cell differentiation; tyrosine phosphorylation of JAK2 protein; steroid biosynthetic process; embryo implantation; negative regulation of apoptosis

Disease: Multiple Fibroadenomas Of The Breast; Hyperprolactinemia