Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PROC monoclonal antibody. Western Blot analysis of PROC expression in human liver.)

Mouse anti-Human PROC Monoclonal Antibody | anti-PROC antibody

PROC (Vitamin K-dependent Protein C, Anticoagulant Protein C, Autoprothrombin IIA, Blood Coagulation Factor XIV, Vitamin K-dependent Protein C Light Chain, Vitamin K-dependent Protein C Heavy Chain, Activation Peptide) (HRP)

Gene Names
PROC; PC; APC; PROC1; THPH3; THPH4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PROC; Monoclonal Antibody; PROC (Vitamin K-dependent Protein C; Anticoagulant Protein C; Autoprothrombin IIA; Blood Coagulation Factor XIV; Vitamin K-dependent Protein C Light Chain; Vitamin K-dependent Protein C Heavy Chain; Activation Peptide) (HRP); anti-PROC antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A10
Specificity
Recognizes human PROC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PROC antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa32-131, from human PROC (AAH34377) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFC
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PROC monoclonal antibody. Western Blot analysis of PROC expression in human liver.)

Western Blot (WB) (PROC monoclonal antibody. Western Blot analysis of PROC expression in human liver.)

Western Blot (WB)

(Western Blot analysis of PROC expression in transfected 293T cell line by PROC monoclonal antibody. Lane 1: PROC transfected lysate (Predicted MW: 52.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PROC expression in transfected 293T cell line by PROC monoclonal antibody. Lane 1: PROC transfected lysate (Predicted MW: 52.1kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of PROC transfected lysate using PROC monoclonal antibody and Protein A Magnetic Bead and immunoblotted with PROC rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of PROC transfected lysate using PROC monoclonal antibody and Protein A Magnetic Bead and immunoblotted with PROC rabbit polyclonal antibody.)
Related Product Information for anti-PROC antibody
This gene encodes a vitamin K-dependent plasma glycoprotein. The encoded protein is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form contains a serine protease domain and functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in this gene have been associated with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis.
Product Categories/Family for anti-PROC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
57,556 Da
NCBI Official Full Name
Homo sapiens protein C (inactivator of coagulation factors Va and VIIIa), mRNA
NCBI Official Synonym Full Names
protein C, inactivator of coagulation factors Va and VIIIa
NCBI Official Symbol
PROC
NCBI Official Synonym Symbols
PC; APC; PROC1; THPH3; THPH4
NCBI Protein Information
vitamin K-dependent protein C
Protein Family

NCBI Description

This gene encodes a vitamin K-dependent plasma glycoprotein. The encoded protein is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form contains a serine protease domain and functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in this gene have been associated with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis.[provided by RefSeq, Dec 2009]

Research Articles on PROC

Similar Products

Product Notes

The PROC (Catalog #AAA6154359) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PROC (Vitamin K-dependent Protein C, Anticoagulant Protein C, Autoprothrombin IIA, Blood Coagulation Factor XIV, Vitamin K-dependent Protein C Light Chain, Vitamin K-dependent Protein C Heavy Chain, Activation Peptide) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PROC can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PROC for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PROC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.