Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MATKSample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MATK Polyclonal Antibody | anti-MATK antibody

MATK Antibody - C-terminal region

Gene Names
MATK; CHK; CTK; HYL; Lsk; HYLTK; HHYLTK
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MATK; Polyclonal Antibody; MATK Antibody - C-terminal region; anti-MATK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGSTSPRSQEP
Sequence Length
507
Applicable Applications for anti-MATK antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MATK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MATKSample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MATKSample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MATK antibody
This is a rabbit polyclonal antibody against MATK. It was validated on Western Blot

Target Description: The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack of a negative regulatory phosphorylation site, and lack of an autophosphorylation site. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer. Three alternatively spliced transcript variants that encode different isoforms have been described for this gene.
Product Categories/Family for anti-MATK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
megakaryocyte-associated tyrosine-protein kinase isoform a
NCBI Official Synonym Full Names
megakaryocyte-associated tyrosine kinase
NCBI Official Symbol
MATK
NCBI Official Synonym Symbols
CHK; CTK; HYL; Lsk; HYLTK; HHYLTK
NCBI Protein Information
megakaryocyte-associated tyrosine-protein kinase
UniProt Protein Name
Megakaryocyte-associated tyrosine-protein kinase
Protein Family
UniProt Gene Name
MATK
UniProt Synonym Gene Names
CTK; HYL; CHK
UniProt Entry Name
MATK_HUMAN

NCBI Description

The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack of a negative regulatory phosphorylation site, and lack of an autophosphorylation site. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer. Three alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CTK: a non-receptor tyrosine kinase. Could play a significant role in the signal transduction of hematopoietic cells. May regulate tyrosine kinase activity of SRC-family members in brain by specifically phosphorylating their C-terminal regulatory tyrosine residue which acts as a negative regulatory site. It may play an inhibitory role in the control of T-cell proliferation. Expressed in cancerous but not normal breast tissue; interacts with activated ERBB2 receptor and is likely to inhibit proliferation.

Protein type: Protein kinase, tyrosine (non-receptor); Kinase, protein; Protein kinase, TK; EC 2.7.10.2; TK group; Csk family

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: extrinsic to internal side of plasma membrane; cytosol

Molecular Function: protein binding; protein-tyrosine kinase activity; non-membrane spanning protein tyrosine kinase activity; ATP binding; receptor binding

Biological Process: cell proliferation; cell migration; positive regulation of cell proliferation; morphogenesis of an epithelium; innate immune response; mesoderm development; cell differentiation; protein amino acid phosphorylation; transmembrane receptor protein tyrosine kinase signaling pathway; regulation of cell proliferation

Research Articles on MATK

Similar Products

Product Notes

The MATK matk (Catalog #AAA3219190) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MATK Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MATK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MATK matk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSCWEAEPAR RPPFRKLAEK LARELRSAGA PASVSGQDAD GSTSPRSQEP. It is sometimes possible for the material contained within the vial of "MATK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.