Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Mouse anti-Human Probable Tubulin Polyglutamylase TTLL1 Monoclonal Antibody | anti-TTLL1 antibody

Probable Tubulin Polyglutamylase TTLL1 (Tubulin--tyrosine Ligase-like Protein 1, TTLL1, Tubulin Polyglutamylase Complex Subunit 3, PGs3, C22orf7, HS323M22B) (FITC)

Gene Names
TTLL1; C22orf7; HS323M22B
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Probable Tubulin Polyglutamylase TTLL1; Monoclonal Antibody; Probable Tubulin Polyglutamylase TTLL1 (Tubulin--tyrosine Ligase-like Protein 1; TTLL1; Tubulin Polyglutamylase Complex Subunit 3; PGs3; C22orf7; HS323M22B) (FITC); EC=6.-.-.-; anti-TTLL1 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C6
Specificity
Recognizes human TTLL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-TTLL1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant protein corresponding to aa1-424 from TTLL1 (AAH14968) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAGKVKWVTDIEKSVLINNFEKRGWVQVTENEDWNFYWMSVQTIRNVFSVEAGYRLSDDQIVNHFPNHYELTRKDLMVKNIKRYRKELEKEGSPLAEKDENGKYLYLDFVPVTYMLPADYNLFVEEFRKSPSSTWIMKPCGKAQGKGIFLINKLSQIKKWSRDSKTSSFVSQSNKEAYVISLYINNPLLIGGRKFDLRLYVLVSTYRPLRCYMYKLGFCRFCTVKYTPSTSELDNMFVHPTNVAIQKHGEDYNHI
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TTLL1 is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-TTLL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
45,493 Da
NCBI Official Full Name
Homo sapiens tubulin tyrosine ligase-like family, member 1, mRNA
NCBI Official Synonym Full Names
tubulin tyrosine ligase like 1
NCBI Official Symbol
TTLL1
NCBI Official Synonym Symbols
C22orf7; HS323M22B
NCBI Protein Information
probable tubulin polyglutamylase TTLL1

Research Articles on TTLL1

Similar Products

Product Notes

The TTLL1 (Catalog #AAA6150279) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Probable Tubulin Polyglutamylase TTLL1 (Tubulin--tyrosine Ligase-like Protein 1, TTLL1, Tubulin Polyglutamylase Complex Subunit 3, PGs3, C22orf7, HS323M22B) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Probable Tubulin Polyglutamylase TTLL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TTLL1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Probable Tubulin Polyglutamylase TTLL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual