Mouse PRKCDBP Monoclonal Antibody | anti-PRKCDBP antibody

PRKCDBP (Protein Kinase C, delta Binding Protein, HSRBC, MGC20400, SRBC) (Biotin)

Cat. Num. AAA6174256

• Gene Names: PRKCDBP; SRBC; HSRBC; CAVIN3; cavin-3
• Applications: Western Blot
• Purity: Purified
• Synonyms: PRKCDBP; Monoclonal Antibody; PRKCDBP (Protein Kinase C; delta Binding Protein; HSRBC; MGC20400; SRBC) (Biotin); Protein Kinase C; SRBC; anti-PRKCDBP antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 8D3
• Specificity: Recognizes PRKCDBP.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-PRKCDBP antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PRKCDBP (NP_659477, 161aa-261aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EVGESSDEEPVESRAQRLRRTGLQKVQSLRRALSGRKGPAAPPPTPVKPPRLGPGRSAEAQPEAQPALEPTLEPEPPQDTEEDPGRPGAAEEALLQMESVA
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PRKCDBP expression in transfected 293T cell line by PRKCDBP monoclonal antibody (M04), clone 8D3.Lane 1: PRKCDBP transfected lysate (Predicted MW: 27.6 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PRKCDBP is 0.3 ng/ml as a capture antibody.)

Related Product Information for anti-PRKCDBP antibody

Mouse monoclonal antibody raised against a partial recombinant PRKCDBP.

Product Categories/Family for anti-PRKCDBP antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 47132587
• NCBI GeneID: 112464
• NCBI Accession #: NP_659477
• NCBI GenBank Nucleotide #: NM_145040.2
• UniProt Accession #: Q969G5
• Molecular Weight: 29 kDa
• NCBI Official Full Name: protein kinase C delta-binding protein
• NCBI Official Synonym Full Names: protein kinase C, delta binding protein
• NCBI Official Symbol: PRKCDBP
• NCBI Official Synonym Symbols: SRBC; HSRBC; CAVIN3; cavin-3
• NCBI Protein Information: protein kinase C delta-binding protein; sdr-related gene product that binds to c-kinase; serum deprivation response factor-related gene product that binds to C-kinase
• UniProt Protein Name: Protein kinase C delta-binding protein
• Protein Family: Protein kinase C delta-binding protein
• UniProt Gene Name: PRKCDBP
• UniProt Synonym Gene Names: SRBC; hSRBC
• UniProt Entry Name: PRDBP_HUMAN

NCBI Description

The protein encoded by this gene was identified as a binding protein of the protein kinase C, delta (PRKCD). The expression of this gene in cultured cell lines is strongly induced by serum starvation. The expression of this protein was found to be down-regulated in various cancer cell lines, suggesting the possible tumor suppressor function of this protein. [provided by RefSeq, Jul 2008]

Uniprot Description

PRKCDBP: Seems to have an immune potentiation function. Belongs to the PTRF/SDPR family.

Protein type: Tumor suppressor

Chromosomal Location of Human Ortholog: 11p15.4

Cellular Component: protein complex; cytoplasm; caveola

Molecular Function: protein binding; protein kinase C binding

Biological Process: negative regulation of protein kinase B signaling cascade; cortical actin cytoskeleton organization and biogenesis; circadian regulation of gene expression