Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PRKCBP1 Monoclonal Antibody | anti-PRKCBP1 antibody

PRKCBP1 (Protein Kinase C-binding Protein 1, Rack7, Cutaneous T-cell Lymphoma-associated Antigen se14-3, CTCL-associated Antigen se14-3, ZMYND8, KIAA1125, RACK7) (MaxLight 550)

Gene Names
ZMYND8; RACK7; PRKCBP1; PRO2893
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRKCBP1; Monoclonal Antibody; PRKCBP1 (Protein Kinase C-binding Protein 1; Rack7; Cutaneous T-cell Lymphoma-associated Antigen se14-3; CTCL-associated Antigen se14-3; ZMYND8; KIAA1125; RACK7) (MaxLight 550); anti-PRKCBP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5B12
Specificity
Recognizes human PRKCBP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
1135
Applicable Applications for anti-PRKCBP1 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 0.25ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa601-699 from PRKCBP1 (NP_898869) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHL*
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-PRKCBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
protein kinase C-binding protein 1 isoform c
NCBI Official Synonym Full Names
zinc finger MYND-type containing 8
NCBI Official Symbol
ZMYND8
NCBI Official Synonym Symbols
RACK7; PRKCBP1; PRO2893
NCBI Protein Information
protein kinase C-binding protein 1
UniProt Protein Name
Protein kinase C-binding protein 1
UniProt Gene Name
ZMYND8
UniProt Synonym Gene Names
KIAA1125; PRKCBP1; RACK7; CTCL-associated antigen se14-3
UniProt Entry Name
PKCB1_HUMAN

NCBI Description

The protein encoded by this gene is a receptor for activated C-kinase (RACK) protein. The encoded protein has been shown to bind in vitro to activated protein kinase C beta I. In addition, this protein is a cutaneous T-cell lymphoma-associated antigen. Finally, the protein contains a bromodomain and two zinc fingers, and is thought to be a transcriptional regulator. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

RACK7: a DNA damage response (DDR) protein, receptor for activated C-kinase (RACK) protein, and a transcriptional regulator. A bromodomain (BRD)-containing protein that recruits the nucleosome remodeling and histone deacetylation (NuRD) complex to damaged chromatin. Targets DNA damage within actively transcribed regions, repressing transcription, and promoting repair by homologous recombination. A cutaneous T-cell lymphoma-associated antigen that contains a bromodomain and two zinc fingers. Twenty-two alternatively spliced isoforms of the human protein hve been reported. Note: This description may include information from UniProtKB

Protein type: Transcription regulation

Chromosomal Location of Human Ortholog: 20q13.12

Cellular Component: nucleus

Molecular Function: protein binding; zinc ion binding

Biological Process: negative regulation of transcription from RNA polymerase II promoter

Research Articles on PRKCBP1

Similar Products

Product Notes

The PRKCBP1 zmynd8 (Catalog #AAA6213346) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRKCBP1 (Protein Kinase C-binding Protein 1, Rack7, Cutaneous T-cell Lymphoma-associated Antigen se14-3, CTCL-associated Antigen se14-3, ZMYND8, KIAA1125, RACK7) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRKCBP1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 0.25ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRKCBP1 zmynd8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKCBP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.