Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PRKAA2 expression in transfected 293T cell line by PRKAA2 monoclonal antibody. Lane 1: PRKAA2 transfected lysate (62.3kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human PRKAA2 Monoclonal Antibody | anti-PRKAA2 antibody

PRKAA2 (AMPK, AMPK2, 5'-AMP-activated Protein Kinase Catalytic Subunit alpha-2, Acetyl-CoA Carboxylase Kinase, Hydroxymethylglutaryl-CoA Reductase Kinase) (FITC)

Gene Names
PRKAA2; AMPK; AMPK2; PRKAA; AMPKa2
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRKAA2; Monoclonal Antibody; PRKAA2 (AMPK; AMPK2; 5'-AMP-activated Protein Kinase Catalytic Subunit alpha-2; Acetyl-CoA Carboxylase Kinase; Hydroxymethylglutaryl-CoA Reductase Kinase) (FITC); anti-PRKAA2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G8
Specificity
Recognizes human PRKAA2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PRKAA2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa453-552 from human PRKAA2 (NP_006243) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PRKAA2 expression in transfected 293T cell line by PRKAA2 monoclonal antibody. Lane 1: PRKAA2 transfected lysate (62.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PRKAA2 expression in transfected 293T cell line by PRKAA2 monoclonal antibody. Lane 1: PRKAA2 transfected lysate (62.3kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PRKAA2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PRKAA2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PRKAA2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PRKAA2 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of PRKAA2 over-expressed 293 cell line, cotransfected with PRKAA2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PRKAA2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PRKAA2 over-expressed 293 cell line, cotransfected with PRKAA2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PRKAA2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between STK11 and PRKAA2 HeLa cells were stained with STK11 rabbit purified polyclonal 1:1200 and PRKAA2 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between STK11 and PRKAA2 HeLa cells were stained with STK11 rabbit purified polyclonal 1:1200 and PRKAA2 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)
Product Categories/Family for anti-PRKAA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,320 Da
NCBI Official Full Name
5'-AMP-activated protein kinase catalytic subunit alpha-2
NCBI Official Synonym Full Names
protein kinase, AMP-activated, alpha 2 catalytic subunit
NCBI Official Symbol
PRKAA2
NCBI Official Synonym Symbols
AMPK; AMPK2; PRKAA; AMPKa2
NCBI Protein Information
5'-AMP-activated protein kinase catalytic subunit alpha-2; 5'-AMP-activated protein kinase, catalytic alpha-2 chain; ACACA kinase; AMP-activated protein kinase alpha-2 subunit variant 2; AMP-activated protein kinase alpha-2 subunit variant 3; AMPK alpha 2
UniProt Protein Name
5'-AMP-activated protein kinase catalytic subunit alpha-2
UniProt Gene Name
PRKAA2
UniProt Synonym Gene Names
AMPK; AMPK2; AMPK subunit alpha-2; ACACA kinase; HMGCR kinase
UniProt Entry Name
AAPK2_HUMAN

Uniprot Description

AMPKA2: a catalytic subunit of AMP-activated protein kinase (AMPK). Acts as an energy sensor, playing a key role in regulating cellular energy metabolism. A protein kinase of the CAMKL family whose activation is regulated by the balance between ADP/AMP/ATP, and intracellular Ca(2+) levels. Acts as a metabolic stress-sensing protein kinase switching off biosynthetic pathways when cellular ATP levels are depleted and when 5'-ADP and -AMP rise in response to fuel limitation and/or hypoxia. Activates energy-producing pathways and inhibits energy-consuming processes. Restores ATP levels in cells by switching off anabolic and switching on catabolic pathways. Activated primarily by rising ADP levels and not, as previously thought, solely by AMP. AMPK resembles an adenylate charge regulatory system in which anabolic and catabolic pathways are regulated by adenine nucleotide ratios. Acts via direct phosphorylation of metabolic enzymes and transcription regulators. Regulates fatty acid synthesis by phosphorylating acetyl-CoA carboxylase. Regulates cholesterol synthesis by phosphorylating and inactivating hormone-sensitive lipase and hydroxymethylglutaryl-CoA reductase. Activated by at least two distinct upstream kinases: the tumor suppressor LKB1 and CaMKK2. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton, probably by indirectly activating myosin. AMPK is a heterotrimer of an alpha catalytic subunit (AMPKA1 or -2), a beta (AMPKB1 or -2) and a gamma non-catalytic subunit (AMPKG1, -2 or -3). Different possible combinations of subunits give rise to 12 different holoenzymes. Binding of ADP or AMP to non-catalytic gamma subunit (PRKAG1, -2 or -3) results in allosteric activation. AMPK is activated by antihyperglycemic drug metformin, a drug prescribed to patients with type 2 diabetes: in vivo, metformin seems to mainly inhibit liver gluconeogenesis. However, metformin can be used to activate AMPK in muscle and other cells in culture or ex vivo. Selectively inhibited by compound C (6-[4-(2-Piperidin-1-yl-ethoxy)-phenyl)]-3-pyridin-4-yl-pyyrazolo[1,5-a] pyrimidine. Activated by resveratrol, a natural polyphenol present in red wine, and S17834, a synthetic polyphenol. Salicylate/aspirin directly activates kinase activity. Studies in the mouse suggest that AMPK2 may control whole-body insulin sensitivity and is necessary for maintaining myocardial energy homeostasis during ischemia.

Protein type: Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.27; EC 2.7.11.1; Kinase, protein; Autophagy; Protein kinase, CAMK; EC 2.7.11.31; CAMK group; CAMKL family; AMPK subfamily

Chromosomal Location of Human Ortholog: 1p31

Cellular Component: nucleoplasm; cytosol

Molecular Function: AMP-activated protein kinase activity; protein serine/threonine kinase activity; protein binding; metal ion binding; [acetyl-CoA carboxylase] kinase activity; protein serine/threonine/tyrosine kinase activity; chromatin binding; histone serine kinase activity; ATP binding; protein kinase activity; [hydroxymethylglutaryl-CoA reductase (NADPH)] kinase activity

Biological Process: lipid biosynthetic process; rhythmic process; cellular lipid metabolic process; carnitine shuttle; glucose homeostasis; signal transduction; protein amino acid phosphorylation; cellular response to glucose starvation; cellular response to nutrient levels; regulation of fatty acid biosynthetic process; regulation of transcription, DNA-dependent; response to stress; cell cycle arrest; positive regulation of autophagy; fatty acid biosynthetic process; mitochondrion organization and biogenesis; negative regulation of TOR signaling pathway; Wnt receptor signaling pathway; transcription, DNA-dependent; organelle organization and biogenesis; regulation of circadian rhythm; cholesterol biosynthetic process; fatty acid homeostasis; positive regulation of glycolysis; insulin receptor signaling pathway; energy reserve metabolic process; autophagy; negative regulation of apoptosis

Similar Products

Product Notes

The PRKAA2 prkaa2 (Catalog #AAA6149033) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRKAA2 (AMPK, AMPK2, 5'-AMP-activated Protein Kinase Catalytic Subunit alpha-2, Acetyl-CoA Carboxylase Kinase, Hydroxymethylglutaryl-CoA Reductase Kinase) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRKAA2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRKAA2 prkaa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKAA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.