Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.95kD), cat# MBS6011911.)

Mouse anti-Human C3 (Complement C3, CPAMD1, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 1) Monoclonal Antibody | anti-C3 antibody

C3 (Complement C3, CPAMD1, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 1)

Gene Names
C3; ASP; C3a; C3b; AHUS5; ARMD9; CPAMD1
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
C3 (Complement C3; CPAMD1; C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 1); Monoclonal Antibody; Anti -C3 (Complement C3; anti-C3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5F9
Specificity
Recognizes human C3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
DKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQK
Applicable Applications for anti-C3 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa1534-1644 from human C3 (NP_000055) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.95kD), cat# MBS6011911.)

Western Blot (WB) (Western Blot detection against Immunogen (37.95kD), cat# MBS6011911.)

Western Blot (WB)

(C3 monoclonal antibody, MBS6011911, Western Blot analysis of C3 expression in A-431.)

Western Blot (WB) (C3 monoclonal antibody, MBS6011911, Western Blot analysis of C3 expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to C3, cat# MBS6011911, on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to C3, cat# MBS6011911, on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged C3, cat# MBS6011911, is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged C3, cat# MBS6011911, is ~1ng/ml as a capture antibody.)
Related Product Information for anti-C3 antibody
C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates. Derived from proteolytic degradation of complement C3, C3a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.
Product Categories/Family for anti-C3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
718
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
187,148 Da
NCBI Official Full Name
complement C3
NCBI Official Synonym Full Names
complement component 3
NCBI Official Symbol
C3
NCBI Official Synonym Symbols
ASP; C3a; C3b; AHUS5; ARMD9; CPAMD1
NCBI Protein Information
complement C3; prepro-C3; C3a anaphylatoxin; complement component C3; complement component C3a; complement component C3b; acylation-stimulating protein cleavage product; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1
UniProt Protein Name
Complement C3
Protein Family
UniProt Gene Name
C3
UniProt Synonym Gene Names
CPAMD1; ASP
UniProt Entry Name
CO3_HUMAN

NCBI Description

Complement component C3 plays a central role in the activation of complement system. Its activation is required for both classical and alternative complement activation pathways. People with C3 deficiency are susceptible to bacterial infection. [provided by RefSeq, Feb 2009]

Uniprot Description

C3: C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates. Defects in C3 are the cause of complement component 3 deficiency (C3D). A rare defect of the complement classical pathway. Patients develop recurrent, severe, pyogenic infections because of ineffective opsonization of pathogens. Some patients may also develop autoimmune disorders, such as arthralgia and vasculitic rashes, lupus-like syndrome and membranoproliferative glomerulonephritis. Genetic variation in C3 is associated with susceptibility to age-related macular degeneration type 9 (ARMD9). ARMD is a multifactorial eye disease and the most common cause of irreversible vision loss in the developed world. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid that lie beneath the retinal pigment epithelium and within an elastin- containing structure known as Bruch membrane. Defects in C3 are a cause of susceptibility to hemolytic uremic syndrome atypical type 5 (AHUS5). An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype. Increased levels of C3 and its cleavage product ASP, are associated with obesity, diabetes and coronary heart disease. Short-term endurance training reduces baseline ASP levels and subsequently fat storage.

Protein type: Secreted, signal peptide; Secreted; Inhibitor

Chromosomal Location of Human Ortholog: 19p13.3-p13.2

Cellular Component: extracellular space; extracellular region; plasma membrane

Molecular Function: protein binding; endopeptidase inhibitor activity; C5L2 anaphylatoxin chemotactic receptor binding; receptor binding

Biological Process: G-protein coupled receptor protein signaling pathway; positive regulation of angiogenesis; regulation of immune response; positive regulation of activation of membrane attack complex; positive regulation of G-protein coupled receptor protein signaling pathway; positive regulation of type IIa hypersensitivity; complement activation, alternative pathway; regulation of complement activation; innate immune response; immune response; positive regulation of protein amino acid phosphorylation; signal transduction; inflammatory response; fatty acid metabolic process; complement activation, classical pathway; complement activation

Disease: Complement Component 3 Deficiency, Autosomal Recessive; Hemolytic Uremic Syndrome, Atypical, Susceptibility To, 5; Macular Degeneration, Age-related, 9

Research Articles on C3

Similar Products

Product Notes

The C3 c3 (Catalog #AAA6011911) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The C3 (Complement C3, CPAMD1, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C3 (Complement C3, CPAMD1, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 1) can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the C3 c3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DKACEPGVDY VYKTRLVKVQ LSNDFDEYIM AIEQTIKSGS DEVQVGQQRT FISPIKCREA LKLEEKKHYL MWGLSSDFWG EKPNLSYIIG KDTWVEHWPE EDECQDEENQ K. It is sometimes possible for the material contained within the vial of "C3 (Complement C3, CPAMD1, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 1), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.