Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD) using.)

Mouse anti-Human PREP Monoclonal Antibody | anti-PREP antibody

PREP (PE, Prolyl Endopeptidase, Post-proline Cleaving Enzyme, PEP, MGC16060) (MaxLight 405)

Gene Names
PREP; PE; PEP
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PREP; Monoclonal Antibody; PREP (PE; Prolyl Endopeptidase; Post-proline Cleaving Enzyme; PEP; MGC16060) (MaxLight 405); anti-PREP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2D7
Specificity
Recognizes human PREP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-PREP antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa611-710 from human PREP with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDWIP
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD) using.)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD) using.)

Testing Data

(Detection limit for recombinant GST tagged PREP is 0.3ng/ml using as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PREP is 0.3ng/ml using as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of HeLa cell using (10ug/ml).)

Immunofluorescence (IF) (Immunofluorescence of HeLa cell using (10ug/ml).)
Related Product Information for anti-PREP antibody
Prolyl Endopeptidase is a cytosolic prolyl endopeptidase which cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30aa long. Prolyl endopeptidases have been reported to be involved in the maturation and degradation of peptide hormones and neuropeptides.
Product Categories/Family for anti-PREP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80,700 Da
NCBI Official Full Name
prolyl endopeptidase
NCBI Official Synonym Full Names
prolyl endopeptidase
NCBI Official Symbol
PREP
NCBI Official Synonym Symbols
PE; PEP
NCBI Protein Information
prolyl endopeptidase
UniProt Protein Name
Prolyl endopeptidase
Protein Family
UniProt Gene Name
PREP
UniProt Synonym Gene Names
PEP; PE
UniProt Entry Name
PPCE_HUMAN

Uniprot Description

PREP: Cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Belongs to the peptidase S9A family.

Protein type: EC 3.4.21.26; Protease

Chromosomal Location of Human Ortholog: 6q22

Cellular Component: cytoplasm; membrane

Molecular Function: protein binding; serine-type peptidase activity

Similar Products

Product Notes

The PREP prep (Catalog #AAA6191983) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PREP (PE, Prolyl Endopeptidase, Post-proline Cleaving Enzyme, PEP, MGC16060) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PREP can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PREP prep for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PREP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.