Mouse anti-Human, Mouse NEK10 Monoclonal Antibody | anti-NEK10 antibody

NEK10 (Never in Mitosis A-related Kinase 10, NimA-related Protein Kinase 10, FLJ32685, Serine/Threonine Protein Kinase Nek10, FLJ32685) (Biotin)

Cat. Num. AAA6143141

• Reactivity: Human, Mouse
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NEK10; Monoclonal Antibody; NEK10 (Never in Mitosis A-related Kinase 10; NimA-related Protein Kinase 10; FLJ32685; Serine/Threonine Protein Kinase Nek10; FLJ32685) (Biotin); anti-NEK10 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1C9
• Specificity: Recognizes human NEK10. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1172

• Applicable Applications for anti-NEK10 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa211-301 from human NEK10 (NP_68974) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RYFMEANRNTVTCHHELAVLSHETFEKASLSSSSSGAASLKSELSESADLPPEGFQASYGKDEDRACDEILSDDNFNLENAEKDTYSEVD
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NEK10 monoclonal antibody. Western Blot analysis of NEK10 expression in Raw 264.7.)

Western Blot (WB)

(NEK10 monoclonal antibody. Western Blot analysis of NEK10 expression in NIH/3T3.)

Western Blot (WB)

(Western Blot analysis of NEK10 expression in transfected 293T cell line by NEK10 monoclonal antibody. Lane 1: NEK10 transfected lysate (53.1kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NEK10 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged NEK10 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB)

(NEK10 monoclonal antibody, Western Blot analysis of NEK10 expression in HeLa.)

Product Categories/Family for anti-NEK10 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 207029296
• NCBI Accession #: NP_689747
• NCBI GenBank Nucleotide #: NM_152534
• UniProt Accession #: Q6ZWH5
• NCBI Official Full Name: serine/threonine-protein kinase Nek10 isoform 2
• UniProt Protein Name: Serine/threonine-protein kinase Nek10
• Protein Family: Serine/threonine-protein kinase
• UniProt Gene Name: NEK10
• UniProt Synonym Gene Names: NimA-related protein kinase 10
• UniProt Entry Name: NEK10_HUMAN

Uniprot Description

NEK10: Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, Ser/Thr (non-receptor); Protein kinase, Other; EC 2.7.11.1; Kinase, protein; Other group; NEK family

Chromosomal Location of Human Ortholog: 3p24.1

Molecular Function: protein serine/threonine kinase activity; metal ion binding; ATP binding; protein kinase activity

Biological Process: positive regulation of MAP kinase activity; protein amino acid phosphorylation; positive regulation of protein amino acid autophosphorylation