Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PPP3CC is 0.3 ng/ml as a capture antibody.)

Mouse PPP3CC Monoclonal Antibody | anti-PPP3CC antibody

PPP3CC (Protein Phosphatase 3 (formerly 2B), Catalytic Subunit, gamma isoform, CALNA3) (AP)

Gene Names
PPP3CC; CNA3; CALNA3; PP2Bgamma
Applications
Western Blot
Purity
Purified
Synonyms
PPP3CC; Monoclonal Antibody; PPP3CC (Protein Phosphatase 3 (formerly 2B); Catalytic Subunit; gamma isoform; CALNA3) (AP); Protein Phosphatase 3 (formerly 2B); CALNA3; anti-PPP3CC antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D1
Specificity
Recognizes PPP3CC.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PPP3CC antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PPP3CC (NP_005596.2, 1aa-81aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKIINDGAAILRQEKTMIEVDAPI
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PPP3CC is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PPP3CC is 0.3 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of PPP3CC expression in transfected 293T cell line by PPP3CC monoclonal antibody (M01), clone 4D1.Lane 1: PPP3CC transfected lysate (Predicted MW: 58.1 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PPP3CC expression in transfected 293T cell line by PPP3CC monoclonal antibody (M01), clone 4D1.Lane 1: PPP3CC transfected lysate (Predicted MW: 58.1 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-PPP3CC antibody
Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation and a unique form of calcineurin appears to be associated with the flagellum. The calcineurin holoenzyme is composed of catalytic and regulatory subunits of 60 and 18 kD, respectively. At least 3 genes, calcineurin A-alpha (CALNA1; MIM 114105), calcineurin A-beta (CALNA2; MIM 114106), and calcineurin A-gamma (CALNA3), have been cloned for the catalytic subunit. These genes have been identified in humans, mice, and rats, and are highly conserved between species (90 to 95% amino acid identity). [supplied by OMIM]
Product Categories/Family for anti-PPP3CC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,262 Da
NCBI Official Full Name
serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform 2
NCBI Official Synonym Full Names
protein phosphatase 3, catalytic subunit, gamma isozyme
NCBI Official Symbol
PPP3CC
NCBI Official Synonym Symbols
CNA3; CALNA3; PP2Bgamma
NCBI Protein Information
serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform; CAM-PRP catalytic subunit; calcineurin, testis-specific catalytic subunit; calmodulin-dependent calcineurin A subunit gamma isoform; protein phosphatase 2B, catalytic subunit, gamma
UniProt Protein Name
Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
UniProt Gene Name
PPP3CC
UniProt Synonym Gene Names
CALNA3; CNA3
UniProt Entry Name
PP2BC_HUMAN

NCBI Description

Calcineurin is a calcium-dependent, calmodulin-stimulated protein phosphatase involved in the downstream regulation of dopaminergic signal transduction. Calcineurin is composed of a regulatory subunit and a catalytic subunit. The protein encoded by this gene represents one of the regulatory subunits that has been found for calcineurin. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

PPP3CC: a calmodulin-dependent Ser/Thr phosphatase also known as calcineurin A gamma. Involved in a wide range of biologic activities, acting as a Ca(2 )-dependent modifier of phosphorylation status. The calcineurin holoenzyme is composed of catalytic and regulatory subunits of 60 and 18 kD, respectively.

Protein type: EC 3.1.3.16; Protein phosphatase, Ser/Thr (non-receptor); Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8p21.3

Cellular Component: cytosol

Molecular Function: calmodulin binding; metal ion binding; phosphoprotein phosphatase activity

Biological Process: dephosphorylation; apoptosis

Research Articles on PPP3CC

Similar Products

Product Notes

The PPP3CC ppp3cc (Catalog #AAA6165431) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PPP3CC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPP3CC ppp3cc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPP3CC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.