Mouse PPP3CC Monoclonal Antibody | anti-PPP3CC antibody

PPP3CC (Protein Phosphatase 3 (formerly 2B), Catalytic Subunit, gamma isoform, CALNA3) (AP)

Cat. Num. AAA6165431

• Gene Names: PPP3CC; CNA3; CALNA3; PP2Bgamma
• Applications: Western Blot
• Purity: Purified
• Synonyms: PPP3CC; Monoclonal Antibody; PPP3CC (Protein Phosphatase 3 (formerly 2B); Catalytic Subunit; gamma isoform; CALNA3) (AP); Protein Phosphatase 3 (formerly 2B); CALNA3; anti-PPP3CC antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4D1
• Specificity: Recognizes PPP3CC.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-PPP3CC antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PPP3CC (NP_005596.2, 1aa-81aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKIINDGAAILRQEKTMIEVDAPI
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PPP3CC is 0.3 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of PPP3CC expression in transfected 293T cell line by PPP3CC monoclonal antibody (M01), clone 4D1.Lane 1: PPP3CC transfected lysate (Predicted MW: 58.1 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-PPP3CC antibody

Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation and a unique form of calcineurin appears to be associated with the flagellum. The calcineurin holoenzyme is composed of catalytic and regulatory subunits of 60 and 18 kD, respectively. At least 3 genes, calcineurin A-alpha (CALNA1; MIM 114105), calcineurin A-beta (CALNA2; MIM 114106), and calcineurin A-gamma (CALNA3), have been cloned for the catalytic subunit. These genes have been identified in humans, mice, and rats, and are highly conserved between species (90 to 95% amino acid identity). [supplied by OMIM]

Product Categories/Family for anti-PPP3CC antibody

Antibodies; Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 21361290
• NCBI GeneID: 5533
• NCBI Accession #: NP_005596.2
• NCBI GenBank Nucleotide #: NM_005605.4
• UniProt Accession #: P48454; Q9BSS6; Q9H4M5; B4DRT5
• Molecular Weight: 59,262 Da
• NCBI Official Full Name: serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform 2
• NCBI Official Synonym Full Names: protein phosphatase 3, catalytic subunit, gamma isozyme
• NCBI Official Symbol: PPP3CC
• NCBI Official Synonym Symbols: CNA3; CALNA3; PP2Bgamma
• NCBI Protein Information: serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform; CAM-PRP catalytic subunit; calcineurin, testis-specific catalytic subunit; calmodulin-dependent calcineurin A subunit gamma isoform; protein phosphatase 2B, catalytic subunit, gamma
• UniProt Protein Name: Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
• Protein Family: Serine/threonine-protein phosphatase
• UniProt Gene Name: PPP3CC
• UniProt Synonym Gene Names: CALNA3; CNA3
• UniProt Entry Name: PP2BC_HUMAN

NCBI Description

Calcineurin is a calcium-dependent, calmodulin-stimulated protein phosphatase involved in the downstream regulation of dopaminergic signal transduction. Calcineurin is composed of a regulatory subunit and a catalytic subunit. The protein encoded by this gene represents one of the regulatory subunits that has been found for calcineurin. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

PPP3CC: a calmodulin-dependent Ser/Thr phosphatase also known as calcineurin A gamma. Involved in a wide range of biologic activities, acting as a Ca(2 )-dependent modifier of phosphorylation status. The calcineurin holoenzyme is composed of catalytic and regulatory subunits of 60 and 18 kD, respectively.

Protein type: EC 3.1.3.16; Protein phosphatase, Ser/Thr (non-receptor); Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8p21.3

Cellular Component: cytosol

Molecular Function: calmodulin binding; metal ion binding; phosphoprotein phosphatase activity

Biological Process: dephosphorylation; apoptosis