Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human PPP1R16A Monoclonal Antibody | anti-PPP1R16A antibody

PPP1R16A (Protein Phosphatase 1 Regulatory Subunit 16A, Myosin Phosphatase-targeting Subunit 3, MYPT3, MGC14333) (PE)

Gene Names
PPP1R16A; MYPT3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPP1R16A; Monoclonal Antibody; PPP1R16A (Protein Phosphatase 1 Regulatory Subunit 16A; Myosin Phosphatase-targeting Subunit 3; MYPT3; MGC14333) (PE); anti-PPP1R16A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B12
Specificity
Recognizes human PPP1R16A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PPP1R16A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa429-529 from human PPP1R16A (NP_116291) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DRSVSYQLSPLDSTTPHTLVHDKAHHTLADLKRQRAAAKLQRPPPEGPESPETAEPGLPGDTVTPQPDCGFRAGGDPPLLKLTAPAVEAPVERRPCCLLM
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged PPP1R16A is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PPP1R16A is 3ng/ml as a capture antibody.)
Related Product Information for anti-PPP1R16A antibody
Inhibits protein phosphatase 1 activity toward phosphorylase, myosin light chain and myosin substrates.
Product Categories/Family for anti-PPP1R16A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,811 Da
NCBI Official Full Name
protein phosphatase 1 regulatory subunit 16A
NCBI Official Synonym Full Names
protein phosphatase 1, regulatory subunit 16A
NCBI Official Symbol
PPP1R16A
NCBI Official Synonym Symbols
MYPT3
NCBI Protein Information
protein phosphatase 1 regulatory subunit 16A; myosin phosphatase-targeting subunit 3; protein phosphatase 1, regulatory (inhibitor) subunit 16A; likley ortholog of mouse myosin phosphatase targeting subunit 3
UniProt Protein Name
Protein phosphatase 1 regulatory subunit 16A
UniProt Gene Name
PPP1R16A
UniProt Synonym Gene Names
MYPT3
UniProt Entry Name
PP16A_HUMAN

Uniprot Description

PPP1R16A: Inhibits protein phosphatase 1 activity toward phosphorylase, myosin light chain and myosin substrates.

Protein type: Protein phosphatase, regulatory subunit

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: plasma membrane

Molecular Function: protein binding

Research Articles on PPP1R16A

Similar Products

Product Notes

The PPP1R16A ppp1r16a (Catalog #AAA6159610) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PPP1R16A (Protein Phosphatase 1 Regulatory Subunit 16A, Myosin Phosphatase-targeting Subunit 3, MYPT3, MGC14333) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1R16A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPP1R16A ppp1r16a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPP1R16A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.