Mouse anti-Human PPM1D Monoclonal Antibody | anti-PPM1D antibody

PPM1D (Protein Phosphatase 1D, Protein Phosphatase 2C Isoform delta, PP2C-delta, Protein Phosphatase Magnesium-dependent 1 delta, p53-induced Protein Phosphatase 1, WIP1) (AP)

Cat. Num. AAA6133089

• Gene Names: PPM1D; WIP1; PP2C-DELTA
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PPM1D; Monoclonal Antibody; PPM1D (Protein Phosphatase 1D; Protein Phosphatase 2C Isoform delta; PP2C-delta; Protein Phosphatase Magnesium-dependent 1 delta; p53-induced Protein Phosphatase 1; WIP1) (AP); anti-PPM1D antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4D1
• Specificity: Recognizes human PPM1D.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-PPM1D antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa496-605 from PPM1D (NP_003611) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEESNSGPLMKKHRRNGLSRSSGAQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRKTVCVC*
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(Western Blot analysis of PPM1D expression in transfected 293T cell line by PPM1D monoclonal antibody Lane 1: PPM1D transfected lysate (66.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PPM1D is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-PPM1D antibody

PPM1D is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. Expression of this PPM1D gene is induced in a p53-dependent manner in response to various environmental stresses. While being induced by tumor suppressor protein TP53/p53, this phosphatase negatively regulates the activity of p38 MAP kinase, MAPK/p38, through which it reduces the phosphorylation of p53, and in turn suppresses p53-mediated transcription and apoptosis. This phosphatase thus mediates a feedback regulation of p38-p53 signaling that contributes to growth inhibition and the suppression of stress induced apoptosis. The PPM1D gene is located in a chromosomal region known to be amplified in breast cancer. The amplification of this gene has been detected in both breast cancer cell line and primary breast tumors, which suggests a role of this gene in cancer development.

Product Categories/Family for anti-PPM1D antibody

Antibodies; Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 4505997
• NCBI GeneID: 8493
• NCBI Accession #: NP_003611
• NCBI GenBank Nucleotide #: NM_003620
• UniProt Accession #: Q8IVR6; Q53XP4; Q6P991; O15297
• Molecular Weight: Predicted: 67 kDa; ; Observed: 68 kDa
• NCBI Official Full Name: protein phosphatase 1D
• NCBI Official Synonym Full Names: protein phosphatase, Mg2+/Mn2+ dependent, 1D
• NCBI Official Symbol: PPM1D
• NCBI Official Synonym Symbols: WIP1; PP2C-DELTA
• NCBI Protein Information: protein phosphatase 1D; protein phosphatase Wip1; wild-type p53-induced phosphatase 1; protein phosphatase 2C delta isoform; protein phosphatase 1D magnesium-dependent, delta isoform
• UniProt Protein Name: Protein phosphatase 1D
• Protein Family: Protein phosphatase
• UniProt Gene Name: PPM1D
• UniProt Synonym Gene Names: WIP1; PP2C-delta
• UniProt Entry Name: PPM1D_HUMAN

NCBI Description

The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. The expression of this gene is induced in a p53-dependent manner in response to various environmental stresses. While being induced by tumor suppressor protein TP53/p53, this phosphatase negatively regulates the activity of p38 MAP kinase, MAPK/p38, through which it reduces the phosphorylation of p53, and in turn suppresses p53-mediated transcription and apoptosis. This phosphatase thus mediates a feedback regulation of p38-p53 signaling that contributes to growth inhibition and the suppression of stress induced apoptosis. This gene is located in a chromosomal region known to be amplified in breast cancer. The amplification of this gene has been detected in both breast cancer cell line and primary breast tumors, which suggests a role of this gene in cancer development. [provided by RefSeq, Jul 2008]

Uniprot Description

PPM1D: a magnesium-dependent Ser/Thr phosphatase. A p53-induced phosphatase that interacts with the nuclear isoform of uracil DNA glycosylase, UNG2, and suppresses base excision repair. Might contribute to growth inhibitory pathways activated in response to DNA damage in a p53-dependent manner.

Protein type: Protein phosphatase, Ser/Thr (non-receptor); Motility/polarity/chemotaxis; Cell cycle regulation; EC 3.1.3.16; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 17q23.2

Cellular Component: nucleus

Molecular Function: protein binding; metal ion binding; protein serine/threonine phosphatase activity

Biological Process: negative regulation of cell proliferation; response to radiation; response to bacterium; G2/M transition of mitotic cell cycle; protein amino acid dephosphorylation

Disease: Breast Cancer