Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.12kD).)

Mouse anti-Human PPIL1 Monoclonal Antibody | anti-PPIL1 antibody

PPIL1 (Peptidyl-prolyl Cis-trans Isomerase-like 1, PPIase, Rotamase PPIL1, CYPL1, CGI-124, UNQ2425/PRO4984)

Gene Names
PPIL1; CYPL1; hCyPX; PPIase; CGI-124
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PPIL1; Monoclonal Antibody; PPIL1 (Peptidyl-prolyl Cis-trans Isomerase-like 1; PPIase; Rotamase PPIL1; CYPL1; CGI-124; UNQ2425/PRO4984); Anti -PPIL1 (Peptidyl-prolyl Cis-trans Isomerase-like 1; anti-PPIL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C2
Specificity
Recognizes human PPIL1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Applicable Applications for anti-PPIL1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa76-167, from human PPIL1 (NP_057143, 51645) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.12kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.12kD).)

Western Blot (WB)

(PPIL1 monoclonal antibody, Western Blot analysis of PPIL1 expression in HeLa.)

Western Blot (WB) (PPIL1 monoclonal antibody, Western Blot analysis of PPIL1 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of PPIL1 expression in transfected 293T cell line by PPIL1 monoclonal antibody.|Lane 1: PPIL1 transfected lysate (18.2kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PPIL1 expression in transfected 293T cell line by PPIL1 monoclonal antibody.|Lane 1: PPIL1 transfected lysate (18.2kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PPIL1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PPIL1 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-PPIL1 antibody
This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. [provided by RefSeq]
Product Categories/Family for anti-PPIL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,237 Da
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase-like 1
NCBI Official Synonym Full Names
peptidylprolyl isomerase (cyclophilin)-like 1
NCBI Official Symbol
PPIL1
NCBI Official Synonym Symbols
CYPL1; hCyPX; PPIase; CGI-124
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase-like 1; rotamase PPIL1; cyclophilin-related gene 1
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase-like 1
UniProt Gene Name
PPIL1
UniProt Synonym Gene Names
CYPL1; PPIase
UniProt Entry Name
PPIL1_HUMAN

NCBI Description

This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. [provided by RefSeq, Jul 2008]

Uniprot Description

PPIL1: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing. Belongs to the cyclophilin-type PPIase family. PPIL1 subfamily.

Protein type: Cyclophilin; Isomerase; EC 5.2.1.8; Spliceosome

Chromosomal Location of Human Ortholog: 6p21.1

Molecular Function: protein binding; peptidyl-prolyl cis-trans isomerase activity

Biological Process: nuclear mRNA splicing, via spliceosome; protein peptidyl-prolyl isomerization; protein folding

Research Articles on PPIL1

Similar Products

Product Notes

The PPIL1 ppil1 (Catalog #AAA645313) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PPIL1 (Peptidyl-prolyl Cis-trans Isomerase-like 1, PPIase, Rotamase PPIL1, CYPL1, CGI-124, UNQ2425/PRO4984) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPIL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the PPIL1 ppil1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SIYGKQFEDE LHPDLKFTGA GILAMANAGP DTNGSQFFVT LAPTQWLDGK HTIFGRVCQG IGMVNRVGMV ETNSQDRPVD DVKIIKAYPS G. It is sometimes possible for the material contained within the vial of "PPIL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.