Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PPARD monoclonal antibody (M03), clone 1G4 Western Blot analysis of PPARD expression in K-562.)

Mouse PPARD Monoclonal Antibody | anti-PPARD antibody

PPARD (Peroxisome Proliferator-Activated Receptor delta, FAAR, MGC3931, NR1C2, NUC1, NUCI, NUCII, PPAR-beta, PPARB) (Biotin)

Gene Names
PPARD; FAAR; NUC1; NUCI; NR1C2; NUCII; PPARB
Applications
Western Blot
Purity
Purified
Synonyms
PPARD; Monoclonal Antibody; PPARD (Peroxisome Proliferator-Activated Receptor delta; FAAR; MGC3931; NR1C2; NUC1; NUCI; NUCII; PPAR-beta; PPARB) (Biotin); Peroxisome Proliferator-Activated Receptor delta; PPARB; anti-PPARD antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G4
Specificity
Recognizes PPARD.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PPARD antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PPARD (NP_006229, 56aa-165aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEG
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PPARD monoclonal antibody (M03), clone 1G4 Western Blot analysis of PPARD expression in K-562.)

Western Blot (WB) (PPARD monoclonal antibody (M03), clone 1G4 Western Blot analysis of PPARD expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged PPARD is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PPARD is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-PPARD antibody
This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. PPARs are nuclear hormone receptors that bind peroxisome proliferators and control the size and number of peroxisomes produced by cells. PPARs mediate a variety of biological processes, and may be involved in the development of several chronic diseases, including diabetes, obesity, atherosclerosis, and cancer. This protein is a potent inhibitor of ligand-induced transcription activity of PPAR alpha and PPAR gamma. It may function as an integrator of transcription repression and nuclear receptor signaling. The expression of this gene is found to be elevated in colorectal cancer cells. The elevated expression can be repressed by adenomatosis polyposis coli (APC), a tumor suppressor protein related to APC/beta-catenin signaling pathway. Knockout studies in mice suggested the role of this protein in myelination of the corpus callosum, lipid metabolism, and epidermal cell proliferation. [provided by RefSeq]
Product Categories/Family for anti-PPARD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
peroxisome proliferator-activated receptor delta isoform 1
NCBI Official Synonym Full Names
peroxisome proliferator activated receptor delta
NCBI Official Symbol
PPARD
NCBI Official Synonym Symbols
FAAR; NUC1; NUCI; NR1C2; NUCII; PPARB
NCBI Protein Information
peroxisome proliferator-activated receptor delta
UniProt Protein Name
Peroxisome proliferator-activated receptor delta
UniProt Gene Name
PPARD
UniProt Synonym Gene Names
NR1C2; PPARB; PPAR-delta; NUC1; PPAR-beta
UniProt Entry Name
PPARD_HUMAN

NCBI Description

This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. The encoded protein is thought to function as an integrator of transcriptional repression and nuclear receptor signaling. It may inhibit the ligand-induced transcriptional activity of peroxisome proliferator activated receptors alpha and gamma, though evidence for this effect is inconsistent. Expression of this gene in colorectal cancer cells may be variable but is typically relatively low. Knockout studies in mice suggested a role for this protein in myelination of the corpus callosum, lipid metabolism, differentiation, and epidermal cell proliferation. Alternative splicing results in multiple transcript variants encoding distinct protein isoforms. [provided by RefSeq, Aug 2017]

Uniprot Description

PPAR-delta: Ligand-activated transcription factor. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand. Belongs to the nuclear hormone receptor family. NR1 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Nuclear receptor

Chromosomal Location of Human Ortholog: 6p21.2

Cellular Component: nucleoplasm; nucleus

Molecular Function: NF-kappaB binding; ligand-dependent nuclear receptor activity; protein binding; DNA binding; zinc ion binding; sequence-specific DNA binding; transcription coactivator activity; steroid hormone receptor activity; drug binding; transcription factor activity; lipid binding

Biological Process: proteoglycan metabolic process; wound healing; negative regulation of smooth muscle cell proliferation; negative regulation of collagen biosynthetic process; heart development; positive regulation of transcription, DNA-dependent; positive regulation of epidermis development; negative regulation of smooth muscle cell migration; glucose transport; negative regulation of transcription from RNA polymerase II promoter; decidualization; positive regulation of vasodilation; vitamin A metabolic process; response to vitamin A; positive regulation of cell proliferation; response to glucose stimulus; axon ensheathment; cell differentiation; negative regulation of epithelial cell proliferation; transcription initiation from RNA polymerase II promoter; cholesterol metabolic process; generation of precursor metabolites and energy; intracellular receptor-mediated signaling pathway; glucose metabolic process; positive regulation of insulin secretion; fatty acid catabolic process; keratinocyte proliferation; keratinocyte migration; cell-substrate adhesion; phospholipid biosynthetic process; regulation of transcription from RNA polymerase II promoter; positive regulation of phosphoinositide 3-kinase cascade; cell proliferation; fatty acid beta-oxidation; negative regulation of inflammatory response; mRNA transcription; positive regulation of fat cell differentiation; steroid hormone mediated signaling; gene expression; lipid metabolic process; negative regulation of cell growth; response to activity; negative regulation of transcription, DNA-dependent; fatty acid transport; embryo implantation; negative regulation of apoptosis

Research Articles on PPARD

Similar Products

Product Notes

The PPARD ppard (Catalog #AAA6171176) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PPARD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPARD ppard for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPARD, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.