Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human POLD3 Monoclonal Antibody | anti-POLD3 antibody

POLD3 (KIAA0039, DNA Polymerase delta Subunit 3, DNA Polymerase delta Subunit p66, MGC119642, MGC119643) (FITC)

Gene Names
POLD3; P66; P68; PPP1R128
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
POLD3; Monoclonal Antibody; POLD3 (KIAA0039; DNA Polymerase delta Subunit 3; DNA Polymerase delta Subunit p66; MGC119642; MGC119643) (FITC); anti-POLD3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E2
Specificity
Recognizes human POLD3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-POLD3 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa357-466 from human POLD3 (NP_006582) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGCIVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFFQRK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to POLD3 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to POLD3 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged POLD3 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged POLD3 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-POLD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
DNA polymerase delta subunit 3 isoform 1
NCBI Official Synonym Full Names
DNA polymerase delta 3, accessory subunit
NCBI Official Symbol
POLD3
NCBI Official Synonym Symbols
P66; P68; PPP1R128
NCBI Protein Information
DNA polymerase delta subunit 3
UniProt Protein Name
DNA polymerase delta subunit 3
UniProt Gene Name
POLD3
UniProt Synonym Gene Names
KIAA0039
UniProt Entry Name
DPOD3_HUMAN

NCBI Description

This gene encodes the 66-kDa subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein plays a role in regulating the activity of DNA polymerase delta through interactions with other subunits and the processivity cofactor proliferating cell nuclear antigen (PCNA). Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Mar 2012]

Uniprot Description

POLD3: Required for optimal DNA polymerase delta activity.

Protein type: Nucleotide Metabolism - pyrimidine; Nucleotide Metabolism - purine; DNA replication

Chromosomal Location of Human Ortholog: 11q14

Cellular Component: nucleoplasm; delta DNA polymerase complex; mitochondrion; nucleus

Molecular Function: protein binding; DNA-directed DNA polymerase activity

Biological Process: telomere maintenance via semi-conservative replication; DNA synthesis during DNA repair; mismatch repair; base-excision repair; nucleotide-excision repair; transcription-coupled nucleotide-excision repair; telomere maintenance via recombination; mitotic cell cycle; nucleotide-excision repair, DNA gap filling; DNA strand elongation during DNA replication; DNA repair; telomere maintenance

Research Articles on POLD3

Similar Products

Product Notes

The POLD3 pold3 (Catalog #AAA6148948) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POLD3 (KIAA0039, DNA Polymerase delta Subunit 3, DNA Polymerase delta Subunit p66, MGC119642, MGC119643) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POLD3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POLD3 pold3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POLD3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.