Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Odorant-binding protein 2a (OBP2A) Recombinant Protein | OBP2A recombinant protein

Recombinant Human Odorant-binding protein 2a (OBP2A)

Gene Names
OBP2A; OBP; LCN13; OBP2C; OBPIIa; hOBPIIa
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Odorant-binding protein 2a (OBP2A); Recombinant Human Odorant-binding protein 2a (OBP2A); Odorant-binding protein IIa; OBPIIa; OBP2A recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
16-170aa; Full Length of Mature Protein
Sequence
LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for OBP2A recombinant protein
Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.
Product Categories/Family for OBP2A recombinant protein
References
"A novel human odorant-binding protein gene family resulting from genomic duplicons at 9q34: differential expression in the oral and genital spheres." Lacazette E., Gachon A.-M., Pitiot G. Hum. Mol. Genet. 9:289-301(2000)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.8 kDa
NCBI Official Full Name
odorant-binding protein 2a isoform gamma
NCBI Official Synonym Full Names
odorant binding protein 2A
NCBI Official Symbol
OBP2A
NCBI Official Synonym Symbols
OBP; LCN13; OBP2C; OBPIIa; hOBPIIa
NCBI Protein Information
odorant-binding protein 2a
UniProt Protein Name
Odorant-binding protein 2a
Protein Family
UniProt Gene Name
OBP2A
UniProt Synonym Gene Names
OBPIIa
UniProt Entry Name
OBP2A_HUMAN

NCBI Description

This gene encodes a small extracellular protein belonging to the lipocalin superfamily. The protein is thought to transport small, hydrophobic, volatile molecules or odorants through the nasal mucus to olfactory receptors, and may also function as a scavenger of highly concentrated or toxic odors. The protein is expressed as a monomer in the nasal mucus, and can bind diverse types of odorants with a higher affinity for aldehydes and fatty acids. This gene and a highly similar family member are located in a cluster of lipocalin genes on chromosome 9. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

OBP2A: Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids. Belongs to the calycin superfamily. Lipocalin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 9q34

Cellular Component: extracellular region

Molecular Function: odorant binding

Biological Process: response to stimulus; sensory perception of chemical stimulus; sensory perception of smell; transport

Research Articles on OBP2A

Similar Products

Product Notes

The OBP2A obp2a (Catalog #AAA1477950) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 16-170aa; Full Length of Mature Protein. The amino acid sequence is listed below: LSFTLEEEDI TGTWYVKAMV VDKDFPEDRR PRKVSPVKVT ALGGGNLEAT FTFMREDRCI QKKILMRKTE EPGKFSAYGG RKLIYLQELP GTDDYVFYCK DQRRGGLRYM GKLVGRNPNT NLEALEEFKK LVQHKGLSEE DIFMPLQTGS CVLEH . It is sometimes possible for the material contained within the vial of "Odorant-binding protein 2a (OBP2A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.