Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human POGK Monoclonal Antibody | anti-POGK antibody

POGK (KIAA1513, Pogo Transposable Element with KRAB Domain, LST003, SLTP003)

Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
POGK; Monoclonal Antibody; POGK (KIAA1513; Pogo Transposable Element with KRAB Domain; LST003; SLTP003); Anti -POGK (KIAA1513; anti-POGK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A9
Specificity
Recognizes human POGK.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEIRCHRYGWMTEDLMQDWLEVVWRRRTGAVPKQRGMLILNGFRGHATDSVKNSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAK
Applicable Applications for anti-POGK antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa431-541 from human POGK (NP_060012) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(POGK monoclonal antibody, Western Blot analysis of POGK expression in HeLa NE.)

Western Blot (WB) (POGK monoclonal antibody, Western Blot analysis of POGK expression in HeLa NE.)

Western Blot (WB)

(Western Blot analysis of POGK expression in transfected 293T cell line by POGK monoclonal antibody.|Lane 1: POGK transfected lysate (69.4kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of POGK expression in transfected 293T cell line by POGK monoclonal antibody.|Lane 1: POGK transfected lysate (69.4kD).|Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to POGK on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to POGK on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged POGK is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged POGK is ~1ng/ml as a capture antibody.)
Related Product Information for anti-POGK antibody
The exact function of the protein encoded by this gene is not known. However, this gene product contains a KRAB domain (which is involved in protein-protein interactions) at the N-terminus, and a transposase domain at the C-terminus, suggesting that it may belong to the family of DNA-mediated transposons in human.
Product Categories/Family for anti-POGK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
pogo transposable element with KRAB domain
NCBI Official Synonym Full Names
pogo transposable element with KRAB domain<
NCBI Official Symbol
POGK
NCBI Protein Information
pogo transposable element with KRAB domain

Similar Products

Product Notes

The POGK (Catalog #AAA6012990) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POGK (KIAA1513, Pogo Transposable Element with KRAB Domain, LST003, SLTP003) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POGK can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the POGK for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEIRCHRYGW MTEDLMQDWL EVVWRRRTGA VPKQRGMLIL NGFRGHATDS VKNSMESMNT DMVIIPGGLT SQLQVLDVVV YKPLNDSVRA QYSNWLLAGN LALSPTGNAK. It is sometimes possible for the material contained within the vial of "POGK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.