Mouse anti-Human PMVK Monoclonal Antibody | anti-PMVK antibody

PMVK (Phosphomevalonate Kinase, hPMK, HUMPMKI, PMK, PMKA, PMKase, PMKASE, PMKI) (FITC)

Cat. Num. AAA6148938

• Gene Names: PMVK; PMK; PMKA; PMKASE; POROK1; HUMPMKI
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PMVK; Monoclonal Antibody; PMVK (Phosphomevalonate Kinase; hPMK; HUMPMKI; PMK; PMKA; PMKase; PMKASE; PMKI) (FITC); anti-PMVK antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2B8
• Specificity: Recognizes human PMVK.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 1225

• Applicable Applications for anti-PMVK antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length recombinant protein corresponding to aa1-192 from PMVK (AAH07694) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (46.86kD).)

Western Blot (WB)

(Western Blot analysis of PMVK expression in transfected 293T cell line by PMVK monoclonal antibody Lane 1: PMVK transfected lysate (22kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of PMVK transfected lysate using PMVK monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PMVK rabbit polyclonal antibody.)

Related Product Information for anti-PMVK antibody

PMVK is a peroxisomal enzyme that catalyzes the conversion of mevalonate 5-phosphate into mevalonate 5-diphosphate as the fifth reaction of the cholesterol biosynthetic pathway. The deduced 192aa PMVK protein has a calculated molecular mass of about 22kD. It contains a C-terminal peroxisomal targeting sequence, and a single methionine is removed from the N terminus upon maturation of the protein. Expression is highest in heart and skeletal muscle, with slightly lower levels in liver, kidney, and pancreas, and low but detectable levels in brain, lung, and placenta.

Product Categories/Family for anti-PMVK antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 33871285
• NCBI GeneID: 10654
• NCBI Official Full Name: Homo sapiens phosphomevalonate kinase, mRNA
• NCBI Official Synonym Full Names: phosphomevalonate kinase
• NCBI Official Symbol: PMVK
• NCBI Official Synonym Symbols: PMK; PMKA; PMKASE; POROK1; HUMPMKI
• NCBI Protein Information: phosphomevalonate kinase

NCBI Description

This gene encodes a peroxisomal enzyme that is a member of the galactokinase, homoserine kinase, mevalonate kinase, and phosphomevalonate kinase (GHMP) family of ATP-dependent enzymes. The encoded protein catalyzes the conversion of mevalonate 5-phosphate to mevalonate 5-diphosphate, which is the fifth step in the mevalonate pathway of isoprenoid biosynthesis. Mutations in this gene are linked to certain types of porokeratosis including disseminated superficial porokeratosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2017]