Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Mouse anti-Human PLCD4 Monoclonal Antibody | anti-plcd4 antibody
PLCD4 (1-phosphatidylinositol 4,5-bisphosphate Phosphodiesterase delta-4, hPLCD4, Phosphoinositide Phospholipase C-delta-4, Phospholipase C-delta-4, PLC-delta-4, MGC12837)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
PLCD4; Monoclonal Antibody; PLCD4 (1-phosphatidylinositol 4; 5-bisphosphate Phosphodiesterase delta-4; hPLCD4; Phosphoinositide Phospholipase C-delta-4; Phospholipase C-delta-4; PLC-delta-4; MGC12837); Anti -PLCD4 (1-phosphatidylinositol 4; anti-plcd4 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D4
Specificity
Recognizes human PLCD4.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPSFSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMRGLQLLVDLVT
Applicable Applications for anti-plcd4 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa18-128 from human PLCD4 (AAH06355) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Testing Data
(Detection limit for recombinant GST tagged PLCD4 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PLCD4 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-plcd4 antibody
Phosphatidylinositol-specific phospholipase C (PLC) plays an important role in receptor-mediated signal transduction by generating 2 second messenger molecules, inositol 1,4,5-triphosphate (IP3) and diacylglycerol, from phosphatidylinositol 4,5-bisphosphate (PIP2). PLC comprises a diverse family of enzymes that differ in structure and tissue distribution (Berridge, 1993 [PubMed 8381210]).
Product Categories/Family for anti-plcd4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
87,417 Da
NCBI Official Full Name
Plcd4 protein
NCBI Official Synonym Full Names
phospholipase C, delta 4<
NCBI Official Symbol
plcd4
NCBI Protein Information
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4; PLC-delta-4; phospholipase C-delta-4; phosphoinositide phospholipase C delta-4; phosphoinositide phospholipase C-delta-4; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 4; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-4
UniProt Protein Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
Protein Family
UniProt Gene Name
plcd4
UniProt Synonym Gene Names
PLC-delta-4
UniProt Entry Name
PLCD4_XENLA
Uniprot Description
Function: Hydrolyzes the phosphatidylinositol 4,5-bisphosphate (PIP2) to generate 2 second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). DAG mediates the activation of protein kinase C (PKC), while IP3 releases Ca2+ from intracellular stores
By similarity.
Catalytic activity: 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.
Cofactor: Binds 3 calcium ions per subunit. Two of the calcium ions are bound to the C2 domain
By similarity.
Subcellular location: Membrane; Peripheral membrane protein
By similarity. Nucleus
By similarity. Cytoplasm
By similarity. Endoplasmic reticulum
By similarity. Note: Localizes primarily to intracellular membranes mostly to the endoplasmic reticulum
By similarity.
Sequence similarities: Contains 1 C2 domain.Contains 3 EF-hand domains.Contains 1 PH domain.Contains 1 PI-PLC X-box domain.Contains 1 PI-PLC Y-box domain.
Similar Products
Product Notes
The plcd4 plcd4 (Catalog #AAA6000546) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PLCD4 (1-phosphatidylinositol 4,5-bisphosphate Phosphodiesterase delta-4, hPLCD4, Phosphoinositide Phospholipase C-delta-4, Phospholipase C-delta-4, PLC-delta-4, MGC12837) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLCD4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the plcd4 plcd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQEGMPMRKV RSKSWKKLRY FRLQNDGMTV WHARQARGSA KPSFSISDVE TIRNGHDSEL LRSLAEELPL EQGFTIVFHG RRSNLDLMAN SVEEAQIWMR GLQLLVDLVT. It is sometimes possible for the material contained within the vial of "PLCD4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
