Western Blot (WB)
(Western Blot analysis of PLA2G1B expression in transfected 293T cell line by PLA2G1B monoclonal antibody (M14), clone 2B7.Lane 1: PLA2G1B transfected lysate (Predicted MW: 16.4 KDa).Lane 2: Non-transfected lysate.)
Mouse PLA2G1B Monoclonal Antibody | anti-PLA2G1B antibody
PLA2G1B (Phospholipase A2, Group IB (pancreas), MGC119834, MGC119835, PLA2, PLA2A, PPLA2) (PE)
Gene Names
PLA2G1B; PLA2; PLA2A; PPLA2
Applications
Western Blot
Purity
Purified
Synonyms
PLA2G1B; Monoclonal Antibody; PLA2G1B (Phospholipase A2; Group IB (pancreas); MGC119834; MGC119835; PLA2; PLA2A; PPLA2) (PE); Phospholipase A2; PPLA2; anti-PLA2G1B antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B7
Specificity
Recognizes PLA2G1B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
70
Applicable Applications for anti-PLA2G1B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PLA2G1B (AAH05386, 17aa-70aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of PLA2G1B expression in transfected 293T cell line by PLA2G1B monoclonal antibody (M14), clone 2B7.Lane 1: PLA2G1B transfected lysate (Predicted MW: 16.4 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PLA2G1B expression in transfected 293T cell line by PLA2G1B monoclonal antibody (M14), clone 2B7.Lane 1: PLA2G1B transfected lysate (Predicted MW: 16.4 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-PLA2G1B antibody
Phospholipase A2 (EC 3.1.1.4) catalyzes the release of fatty acids from glycero-3-phosphocholines. The best known varieties are the digestive enzymes secreted as zymogens by the pancreas of mammals. Sequences of pancreatic PLA2 enzymes from a variety of mammals have been reported. One striking feature of these enzymes is their close homology to venom phospholipases of snakes. Other forms of PLA2 have been isolated from brain, liver, lung, spleen, intestine, macrophages, leukocytes, erythrocytes, inflammatory exudates, chondrocytes, and platelets (Seilhamer et al., 1986 [PubMed 3028739]). [supplied by OMIM]
Product Categories/Family for anti-PLA2G1B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
PLA2G1B protein
NCBI Official Synonym Full Names
phospholipase A2 group IB
NCBI Official Symbol
PLA2G1B
NCBI Official Synonym Symbols
PLA2; PLA2A; PPLA2
NCBI Protein Information
phospholipase A2
Protein Family
NCBI Description
This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids. AA is subsequently converted by downstream metabolic enzymes to several bioactive lipophilic compounds (eicosanoids), including prostaglandins (PGs) and leukotrienes (LTs). The enzyme may be involved in several physiological processes including cell contraction, cell proliferation and pathological response. [provided by RefSeq, Aug 2013]
Research Articles on PLA2G1B
Similar Products
Product Notes
The PLA2G1B (Catalog #AAA6184158) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PLA2G1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PLA2G1B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLA2G1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
