Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-PLA2G16 Polyclonal Antibody)

Rabbit anti-Human PLA2G16 Polyclonal Antibody | anti-PLA2G16 antibody

PLA2G16 Polyclonal Antibody

Gene Names
PLAAT3; AdPLA; HRSL3; HRASLS3; HREV107; PLA2G16; PLAAT-3; H-REV107; HREV107-1; HREV107-3; H-REV107-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
PLA2G16; Polyclonal Antibody; PLA2G16 Polyclonal Antibody; AdPLA; H-REV107; H-REV107-1; HRASLS3; HREV107; HREV107-1; HREV107-3; HRSL3; HRAS-like suppressor 3; anti-PLA2G16 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.04 mg/ml (varies by lot)
Sequence Length
162
Applicable Applications for anti-PLA2G16 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 68-162 of human PLA2G16 (NP_009000.2).
Immunogen Sequence
VAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
Positive Samples
HepG2, HT-29
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-PLA2G16 Polyclonal Antibody)

Western Blot (WB) (Western blot-PLA2G16 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 18kDa
Observed: 18kDa
NCBI Official Full Name
phospholipase A and acyltransferase 3
NCBI Official Synonym Full Names
phospholipase A and acyltransferase 3
NCBI Official Symbol
PLAAT3
NCBI Official Synonym Symbols
AdPLA; HRSL3; HRASLS3; HREV107; PLA2G16; PLAAT-3; H-REV107; HREV107-1; HREV107-3; H-REV107-1
NCBI Protein Information
phospholipase A and acyltransferase 3
UniProt Protein Name
HRAS-like suppressor 3
Protein Family
UniProt Gene Name
PLA2G16
UniProt Synonym Gene Names
HRASLS3; HREV107; HRSL3; AdPLA
UniProt Entry Name
HRSL3_HUMAN

Uniprot Description

PLA2G16: Exhibits PLA1/2 activity, catalyzing the calcium- independent hydrolysis of acyl groups in various phosphotidylcholines (PC) and phosphatidylethanolamine (PE). For most substrates, PLA1 activity is much higher than PLA2 activity. Specifically catalyzes the release of fatty acids from phospholipids in adipose tissue. N- and O- acylation activity is hardly detectable. Might decrease protein phosphatase 2A (PP2A) activity. Belongs to the H-rev107 family.

Protein type: EC 3.1.1.32; EC 3.1.1.4; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q12.3

Cellular Component: endoplasmic reticulum; perinuclear region of cytoplasm; integral to membrane; cytosol

Molecular Function: phospholipase A2 activity; protein binding; phospholipase A1 activity

Biological Process: phospholipid metabolic process; glycerophospholipid biosynthetic process; lipid catabolic process; negative regulation of cell cycle

Research Articles on PLA2G16

Similar Products

Product Notes

The PLA2G16 pla2g16 (Catalog #AAA9140675) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLA2G16 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLA2G16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the PLA2G16 pla2g16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLA2G16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.