Rabbit anti-Human PLA2G16 Polyclonal Antibody | anti-PLA2G16 antibody

PLA2G16 (Group XVI Phospholipase A2, Adipose-specific Phospholipase A2, AdPLA, H-rev 107 Protein Homolog, HRAS-like Suppressor 3, HREV107, HREV107-3, Renal Carcinoma Antigen NY-REN-65, HRASLS3, MGC118754)

Cat. Num. AAA644621

• Gene Names: PLA2G16; AdPLA; HRSL3; HRASLS3; HREV107; HREV107-1; HREV107-3; H-REV107-1
• Reactivity: Human
• Applications: Western Blot, Immunoprecipitation
• Purity: Serum; Serum
• Synonyms: PLA2G16; Polyclonal Antibody; PLA2G16 (Group XVI Phospholipase A2; Adipose-specific Phospholipase A2; AdPLA; H-rev 107 Protein Homolog; HRAS-like Suppressor 3; HREV107; HREV107-3; Renal Carcinoma Antigen NY-REN-65; HRASLS3; MGC118754); Anti -PLA2G16 (Group XVI Phospholipase A2; anti-PLA2G16 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PLA2G16.
• Purity/Purification: Serum; Serum
• Form/Format: Supplied as a liquid.
• Sequence: MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ

• Applicable Applications for anti-PLA2G16 antibody: Western Blot (WB), Immunoprecipitation (IP)
• Application Notes: Suitable for use in Western Blot and Immunoprecipitation.
• Immunogen: Full length human PLA2G16, aa1-162 (AAH01387.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PLA2G16 expression in transfected 293T cell line by PLA2G16 polyclonal antibody. Lane 1: PLA2G16 transfected lysate (17.9kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of PLA2G16 transfected lysate using PLA2G16 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with PLA2G16 purified mouse polyclonal antibody.)

Related Product Information for anti-PLA2G16 antibody

PLA2G16 (Group 16 phospholipase A2; also HREV107 and AdPLA) is a Ca++-dependent 17-18kD member of the H-rev107 family of molecules. It is expressed intracellularly by white adipocytes, induced by insulin, and generates arachadonic acid from phospholipids. The arachadonic acid is converted to PGE2, which binds the EP3 receptor and decreases cAMP levels. This results in decreased hormone-sensitive lipase activity and increased adiposity. Human PLA216 is 16211aa in length. It is associated with both membranes and cytosol, and may possess a transmembrane segment between aa134-154. The enzymatic activity resides in His23 and Cys113. There is one potential isoform that shows a 20aa substitution for the first four amino acids. Over aa12-132, human PLA2G16 shares 88% aa identity with mouse PLA2G16.

Product Categories/Family for anti-PLA2G16 antibody

Antibodies; Abs to Enzymes; Phospholipase

NCBI and Uniprot Product Information

• NCBI GI #: 75517991
• NCBI GeneID: 11145
• UniProt Accession #: P53816; Q3SYI3; Q9HDD1; B2R7Q4; B7XAK5
• Molecular Weight: 17,937 Da
• NCBI Official Full Name: PLA2G16 protein
• NCBI Official Synonym Full Names: phospholipase A2, group XVI
• NCBI Official Symbol: PLA2G16
• NCBI Official Synonym Symbols: AdPLA; HRSL3; HRASLS3; HREV107; HREV107-1; HREV107-3; H-REV107-1
• NCBI Protein Information: HRAS-like suppressor 3; adipose-specific PLA2; HRAS-like suppressor 1; H-rev 107 protein homolog; group XVI phospholipase A2; group XVI phospholipase A1/A2; Ca-independent phospholipase A1/2; adipose-specific phospholipase A2; renal carcinoma antigen NY-REN-65
• UniProt Protein Name: HRAS-like suppressor 3
• Protein Family: HRAS-like suppressor
• UniProt Gene Name: PLA2G16
• UniProt Synonym Gene Names: HRASLS3; HREV107; HRSL3; AdPLA
• UniProt Entry Name: HRSL3_HUMAN

Uniprot Description

PLA2G16: Exhibits PLA1/2 activity, catalyzing the calcium- independent hydrolysis of acyl groups in various phosphotidylcholines (PC) and phosphatidylethanolamine (PE). For most substrates, PLA1 activity is much higher than PLA2 activity. Specifically catalyzes the release of fatty acids from phospholipids in adipose tissue. N- and O- acylation activity is hardly detectable. Might decrease protein phosphatase 2A (PP2A) activity. Belongs to the H-rev107 family.

Protein type: Membrane protein, integral; EC 3.1.1.4; EC 3.1.1.32

Chromosomal Location of Human Ortholog: 11q12.3

Cellular Component: perinuclear region of cytoplasm; endoplasmic reticulum; integral to membrane; cytosol

Molecular Function: phospholipase A2 activity; protein binding; phospholipase A1 activity

Biological Process: phospholipid metabolic process; glycerophospholipid biosynthetic process; lipid catabolic process; negative regulation of cell cycle