Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human PLA2G12A Monoclonal Antibody | anti-PLA2G12A antibody

PLA2G12A (Group XIIA Secretory Phospholipase A2, GXII sPLA2, sPLA2-XII, Phosphatidylcholine 2-acylhydrolase 12A, PLA2G12, FKSG38, UNQ2519/PRO6012, ROSSY) (Biotin)

Gene Names
PLA2G12A; GXII; ROSSY; PLA2G12
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PLA2G12A; Monoclonal Antibody; PLA2G12A (Group XIIA Secretory Phospholipase A2; GXII sPLA2; sPLA2-XII; Phosphatidylcholine 2-acylhydrolase 12A; PLA2G12; FKSG38; UNQ2519/PRO6012; ROSSY) (Biotin); anti-PLA2G12A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D11
Specificity
Recognizes human PLA2G12A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PLA2G12A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa90-189 from human PLA2G12A (NP_110448) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTD
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of PLA2G12A expression in transfected 293T cell line by PLA2G12A monoclonal antibody. Lane 1: PLA2G12A transfected lysate (21.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PLA2G12A expression in transfected 293T cell line by PLA2G12A monoclonal antibody. Lane 1: PLA2G12A transfected lysate (21.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PLA2G12A is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PLA2G12A is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-PLA2G12A antibody
Secreted phospholipase A2 (sPLA2) enzymes liberate arachidonic acid from phospholipids for production of eicosanoids and exert a variety of physiologic and pathologic effects. Group XII sPLA2s, such as PLA2G12A, have relatively low specific activity and are structurally and functionally distinct from other sPLA2s (Gelb et al., 2000 [PubMed 11031251]).
Product Categories/Family for anti-PLA2G12A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,067 Da
NCBI Official Full Name
group XIIA secretory phospholipase A2
NCBI Official Synonym Full Names
phospholipase A2, group XIIA
NCBI Official Symbol
PLA2G12A
NCBI Official Synonym Symbols
GXII; ROSSY; PLA2G12
NCBI Protein Information
group XIIA secretory phospholipase A2; GXII sPLA2; group XII secreted phospholipase A2; group XIIA secreted phospholipase A2; phosphatidylcholine 2-acylhydrolase 12A; phospholipase A2, group XII; sPLA2-XII
UniProt Protein Name
Group XIIA secretory phospholipase A2
UniProt Gene Name
PLA2G12A
UniProt Synonym Gene Names
PLA2G12; GXII sPLA2; sPLA2-XII
UniProt Entry Name
PG12A_HUMAN

Uniprot Description

PLA2G12A: PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl- phosphatidylcholine or -phosphatidylethanolamine. Belongs to the phospholipase A2 family.

Protein type: Phospholipase; Lipid Metabolism - linoleic acid; Lipid Metabolism - glycerophospholipid; Lipid Metabolism - ether lipid; Secreted, signal peptide; Endoplasmic reticulum; Lipid Metabolism - arachidonic acid; EC 3.1.1.4; Secreted; Lipid Metabolism - alpha-linolenic acid

Chromosomal Location of Human Ortholog: 4q25

Cellular Component: Golgi apparatus; endoplasmic reticulum; extracellular region

Molecular Function: calcium-dependent phospholipase A2 activity; calcium ion binding

Biological Process: phospholipid metabolic process; glycerophospholipid biosynthetic process; phosphatidic acid biosynthetic process; lipid catabolic process

Similar Products

Product Notes

The PLA2G12A pla2g12a (Catalog #AAA6143593) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PLA2G12A (Group XIIA Secretory Phospholipase A2, GXII sPLA2, sPLA2-XII, Phosphatidylcholine 2-acylhydrolase 12A, PLA2G12, FKSG38, UNQ2519/PRO6012, ROSSY) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLA2G12A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PLA2G12A pla2g12a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLA2G12A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.