Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human PKD2L1 Monoclonal Antibody | anti-PKD2L1 antibody

PKD2L1 (Polycystic Kidney Disease 2-like 1 Protein, Polycystin-2 Homolog, Polycystin-2L1, Polycystin-L, Polycystin-L1, PKD2L, PKDL, TRPP3) APC

Gene Names
PKD2L1; PCL; PKDL; PKD2L; TRPP3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PKD2L1; Monoclonal Antibody; PKD2L1 (Polycystic Kidney Disease 2-like 1 Protein; Polycystin-2 Homolog; Polycystin-2L1; Polycystin-L; Polycystin-L1; PKD2L; PKDL; TRPP3) APC; anti-PKD2L1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4F9
Specificity
Recognizes human PKD2L1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
805
Applicable Applications for anti-PKD2L1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa173-273 from PKD2L1 (NP_057196) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNGTAWTYHSQDELGGFSHWGRLTSYSGGGYYL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)
Related Product Information for anti-PKD2L1 antibody
PKD2L1 is a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation channel. Alternative splice variants have been described but their full length sequences have not been determined.
Product Categories/Family for anti-PKD2L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
polycystic kidney disease 2-like 1 protein isoform 1
NCBI Official Synonym Full Names
polycystin 2 like 1, transient receptor potential cation channel
NCBI Official Symbol
PKD2L1
NCBI Official Synonym Symbols
PCL; PKDL; PKD2L; TRPP3
NCBI Protein Information
polycystic kidney disease 2-like 1 protein
UniProt Protein Name
Polycystic kidney disease 2-like 1 protein
UniProt Gene Name
PKD2L1
UniProt Synonym Gene Names
PKD2L; PKDL; TRPP3

NCBI Description

This gene encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation channel. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

PKD2L1: May function as a subunit of an ion channel and act as a transducer of calcium-mediated signaling. Belongs to the polycystin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, cation; Membrane protein, integral; Membrane protein, multi-pass; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 10q24.31

Cellular Component: cell surface; endoplasmic reticulum; integral component of membrane; intracellular membrane-bound organelle; membrane; plasma membrane; receptor complex

Molecular Function: alpha-actinin binding; calcium activated cation channel activity; calcium channel activity; calcium ion binding; calcium-activated potassium channel activity; cation channel activity; cation transmembrane transporter activity; cytoskeletal protein binding; identical protein binding; muscle alpha-actinin binding; protein binding; sodium channel activity; sour taste receptor activity

Biological Process: cation transport; detection of chemical stimulus involved in sensory perception of sour taste; detection of mechanical stimulus; sensory perception of sour taste; smoothened signaling pathway

Research Articles on PKD2L1

Similar Products

Product Notes

The PKD2L1 pkd2l1 (Catalog #AAA6138282) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PKD2L1 (Polycystic Kidney Disease 2-like 1 Protein, Polycystin-2 Homolog, Polycystin-2L1, Polycystin-L, Polycystin-L1, PKD2L, PKDL, TRPP3) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PKD2L1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PKD2L1 pkd2l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PKD2L1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.