Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PKD2 is 1 ng/ml as a capture antibody.)

Mouse PKD2 Monoclonal Antibody | anti-PKD2 antibody

PKD2 (polycystic kidney Disease 2 (Autosomal Dominant), APKD2, MGC138466, MGC138468, PC2, PKD4) (PE)

Gene Names
PKD2; PC2; PKD4; Pc-2; APKD2; TRPP2
Applications
Western Blot
Purity
Purified
Synonyms
PKD2; Monoclonal Antibody; PKD2 (polycystic kidney Disease 2 (Autosomal Dominant); APKD2; MGC138466; MGC138468; PC2; PKD4) (PE); polycystic kidney Disease 2 (Autosomal Dominant); PKD4; anti-PKD2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G3
Specificity
Recognizes PKD2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PKD2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PKD2 (NP_000288, 261aa-360aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PKD2 is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PKD2 is 1 ng/ml as a capture antibody.)
Related Product Information for anti-PKD2 antibody
This gene encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. The encoded protein may function in renal tubular development, morphology, and function, and may modulate intracellular calcium homoeostasis and other signal transduction pathways. This protein interacts with polycystin 1 to produce cation-permeable currents. Mutations in this gene have been associated with autosomal dominant polycystic kidney disease. [provided by RefSeq]
Product Categories/Family for anti-PKD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98,838 Da
NCBI Official Full Name
polycystin-2
NCBI Official Synonym Full Names
polycystic kidney disease 2 (autosomal dominant)
NCBI Official Symbol
PKD2
NCBI Official Synonym Symbols
PC2; PKD4; Pc-2; APKD2; TRPP2
NCBI Protein Information
polycystin-2; R48321; autosomal dominant polycystic kidney disease type II protein; polycystwin; transient receptor potential cation channel, subfamily P, member 2
UniProt Protein Name
Polycystin-2
Protein Family
UniProt Gene Name
PKD2
UniProt Entry Name
PKD2_HUMAN

Uniprot Description

PKD2: Involved in fluid-flow mechanosensation by the primary cilium in renal epithelium. PKD1 and PKD2 may function through a common signaling pathway that is necessary for normal tubulogenesis. Acts as a regulator of cilium length, together with PKD1. The dynamic control of cilium length is essential in the regulation of mechanotransductive signaling. The cilium length response creates a negative feedback loop whereby fluid shear-mediated deflection of the primary cilium, which decreases intracellular cAMP, leads to cilium shortening and thus decreases flow-induced signaling. Functions as a calcium permeable cation channel. Defects in PKD2 are the cause of polycystic kidney disease autosomal dominant type 2 (ADPKD2). ADPKD2 is a disorder characterized by progressive formation and enlargement of cysts in both kidneys, typically leading to end-stage renal disease in adult life. Cysts also occurs in the liver and other organs. It represents approximately 15% of the cases of autosomal dominant polycystic kidney disease. ADPKD2 is clinically milder than ADPKD1 but it has a deleterious impact on overall life expectancy. Belongs to the polycystin family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Channel, cation; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 4q22.1

Cellular Component: filamentous actin; endoplasmic reticulum membrane; nonmotile primary cilium; endoplasmic reticulum; integral to plasma membrane; lamellipodium; cytoplasm; basal plasma membrane; plasma membrane; motile primary cilium; intercellular junction; basal cortex; cilium

Molecular Function: voltage-gated cation channel activity; actinin binding; identical protein binding; protein homodimerization activity; phosphoprotein binding; voltage-gated ion channel activity; calcium ion binding; muscle alpha-actinin binding; ATPase binding; calcium-induced calcium release activity; voltage-gated calcium channel activity; protein binding; potassium channel activity; voltage-gated sodium channel activity; cytoskeletal protein binding; HLH domain binding; receptor binding

Biological Process: neural tube development; positive regulation of inositol-1,4,5-triphosphate receptor activity; embryonic placenta development; cytoplasmic sequestering of transcription factor; positive regulation of nitric oxide biosynthetic process; regulation of cAMP metabolic process; heart development; detection of mechanical stimulus; JAK-STAT cascade; liver development; G1/S-specific positive regulation of cyclin-dependent protein kinase activity; regulation of cell proliferation; negative regulation of cell proliferation; ureteric bud branching; spinal cord development; release of sequestered calcium ion into cytosol; calcium ion transport; positive regulation of transcription from RNA polymerase II promoter; heart looping; cell cycle arrest; determination of left/right symmetry; centrosome duplication

Disease: Polycystic Kidney Disease 2

Similar Products

Product Notes

The PKD2 pkd2 (Catalog #AAA6187164) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PKD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PKD2 pkd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PKD2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.