Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PITPNB monoclonal antibody. Western Blot analysis of PITPNB expression in Jurkat.)

Mouse anti-Human PITPNB Monoclonal Antibody | anti-PITPNB antibody

PITPNB (Phosphatidylinositol Transfer Protein beta Isoform, PI-TP-beta, PtdIns Transfer Protein beta, PtdInsTP beta) (Biotin)

Gene Names
PITPNB; VIB1B; PtdInsTP; PI-TP-beta
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PITPNB; Monoclonal Antibody; PITPNB (Phosphatidylinositol Transfer Protein beta Isoform; PI-TP-beta; PtdIns Transfer Protein beta; PtdInsTP beta) (Biotin); anti-PITPNB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D3
Specificity
Recognizes human PITPNB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PITPNB antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa181-272 from PITPNB (NP_036531) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PITPNB monoclonal antibody. Western Blot analysis of PITPNB expression in Jurkat.)

Western Blot (WB) (PITPNB monoclonal antibody. Western Blot analysis of PITPNB expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged PITPNB is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PITPNB is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-PITPNB antibody
The protein encoded by this gene is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.
Product Categories/Family for anti-PITPNB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.7 kDa (291aa) confirmed by MALDI-TOF
NCBI Official Full Name
phosphatidylinositol transfer protein beta isoform isoform 1
NCBI Official Synonym Full Names
phosphatidylinositol transfer protein beta
NCBI Official Symbol
PITPNB
NCBI Official Synonym Symbols
VIB1B; PtdInsTP; PI-TP-beta
NCBI Protein Information
phosphatidylinositol transfer protein beta isoform
UniProt Protein Name
Phosphatidylinositol transfer protein beta isoform
UniProt Gene Name
PITPNB
UniProt Synonym Gene Names
PI-TP-beta; PtdIns transfer protein beta
UniProt Entry Name
PIPNB_HUMAN

NCBI Description

This gene encodes a cytoplasmic protein that catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes. This transfer activity is required for COPI complex-mediated retrograde transport from the Golgi apparatus to the endoplasmic reticulum. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2013]

Uniprot Description

PITPNB: transfers phosphatidylinositol, phosphatidylcholine and sphingomyelin between membrane bilayers. Associates mainly with the trans-Golgi network. Ser-261 is constitutively phosphorylated.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 22q12.1

Cellular Component: Golgi membrane; endoplasmic reticulum membrane

Molecular Function: lipid binding

Biological Process: in utero embryonic development; phospholipid metabolic process; glycerophospholipid biosynthetic process; phospholipid transport; lipid metabolic process

Research Articles on PITPNB

Similar Products

Product Notes

The PITPNB pitpnb (Catalog #AAA6143578) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PITPNB (Phosphatidylinositol Transfer Protein beta Isoform, PI-TP-beta, PtdIns Transfer Protein beta, PtdInsTP beta) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PITPNB can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PITPNB pitpnb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PITPNB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.