Immunohistochemistry (IHC)
(Rabbit Anti-SLC22A7 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Rabbit SLC22A7 Polyclonal Antibody | anti-SLC22A7 antibody
SLC22A7 antibody - N-terminal region
Gene Names
SLC22A7; NLT; OAT2; hOAT11
Reactivity
Cow, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
SLC22A7; Polyclonal Antibody; SLC22A7 antibody - N-terminal region; anti-SLC22A7 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQS
Sequence Length
546
Applicable Applications for anti-SLC22A7 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Rabbit: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-SLC22A7 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Immunohistochemistry (IHC)
(Rabbit Anti-SLC22A7 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Western Blot (WB)
(Host: RabbitTarget Name: SLC22A7Sample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%There is BioGPS gene expression data showing that SLC22A7 is expressed in Jurkat)
Western Blot (WB)
(Host: RabbitTarget Name: SLC22A7Sample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%There is BioGPS gene expression data showing that SLC22A7 is expressed in Jurkat)
Western Blot (WB)
(WB Suggested Anti-SLC22A7 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that SLC22A7 is expressed in Jurkat)
Western Blot (WB)
(WB Suggested Anti-SLC22A7 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that SLC22A7 is expressed in Jurkat)
Related Product Information for anti-SLC22A7 antibody
This is a rabbit polyclonal antibody against SLC22A7. It was validated on Western Blot and immunohistochemistry
Target Description: SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.
Target Description: SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.
Product Categories/Family for anti-SLC22A7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60kDa
NCBI Official Full Name
solute carrier family 22 member 7 isoform a
NCBI Official Synonym Full Names
solute carrier family 22 member 7
NCBI Official Symbol
SLC22A7
NCBI Official Synonym Symbols
NLT; OAT2; hOAT11
NCBI Protein Information
solute carrier family 22 member 7
Protein Family
NCBI Description
The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Research Articles on SLC22A7
Similar Products
Product Notes
The SLC22A7 (Catalog #AAA3206297) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC22A7 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC22A7 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SLC22A7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LPGAPANFSH QDVWLEAHLP REPDGTLSSC LRFAYPQALP NTTLGEERQS. It is sometimes possible for the material contained within the vial of "SLC22A7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
